SecReT4
Protein ID: 340843844
T4SS name [ID]Tra_I [186]
Gene symbol-
Locus tagpGRT1_p057
StrainPseudomonas putida plasmid pGRT1 (NC_015855)
Repliconplasmid pGRT1 [GenBank: NC_015855] [Browse all T4SS(s) in this replicon]
Location [Strand]58265..61345 [+]
ProductTraU protein
Component typeTraU_I
UniProt IDG0WPH4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.6e-52, Aligned region: 496..902
Protein Sequence: 1026 a.a.     [Download]
>gi|340843844|ref|YP_004750594.1| TraU protein [Pseudomonas putida DOT-T1E]
MGLLDKCVDALEGTLEYLAKHFIHKDMTSYCELATAVGLTDADIEKSPDLKDPYTLVNSDYSLLTVFDLQ
GTYQMLSEAEFSEMLESLRVRMTGYMREKGHSLTFSFERDPERATDELMRLAEPLLNTARRIGLKSEDII
LDRVKRNAPHCAWEQNLLVVYTHLTSLSNEEQDRELGELSKKASKHKLPRLVYGQNPAFALAALKYRHDT
MIERLMDDFISCGVEGKKGIMMKPLSAHEAAKRIRIMLNREGTSQKFRPQIVGDRFMFRGATDAKDFSEL
VPPRLSYQICSNDVEPVGNYVKTDSLWHGSLAMELGPQDVVHFTKLFSAVGKKDPWRIRFDIAPGGLSMM
RARRLMVGFVGVLPDNRAIRDSFKSLETIARDEAVMSMKIMASSWSTTKADLETRLSRLEKAIQSWGTCQ
VQKTHGDPMAALASSIPGFTTKNTANRLLPPLKEAMNMLPLQRPATPWPDNGSWITRTPDGKIYPIGLGS
SIQDTWIELVSGIPGSGKSVAANCMHNATLHRPGATQLPLLTIVDVGPSSSGLIQMIQDSLPDHRKAEAA
YLRLQNSRDFASNPFDPQLGARQPTRREREYCVDFLNLLCASVATDGQGGAKARTPSDCAAVNEMLMTLV
YDDKAGRGANQYEQDVVPAVDKVLAESGISAEHDEKWWSAATWYEVTDMLFAAGYVREATYAHRQASPVL
PDFTAMLNNEGVRQTFGEIKTAADEPLLKYMGRCFTLASTTYAVFSGRTRFEVDSTTRVISVDLNDVIGS
KTPEGSIKTSCMYMFARHLGAKNYFLREEDIRLVAPPLYLDYHLKRAEDVASQQKTIAYDEWHNTEGMDT
PVQTLVKDGREGRKWGIRIMVISQYLRDFPLALLNAATSVYVLRGGNVDDENVLRETFKVSHETIQQLHL
QCTGPGRNGANMLALFKTNQGTITQILTNTTGPLELWAMSTTQQDTALRTELYKRIGPMAARQVLAKRFP
LGTAKSHIEALEYASTSNAKLSVVKQLAEDLVTAYYAEQNPRGEHA
 
Nucleotide Sequence: 3081 bp     [Download]
>gi|340843787|ref|NC_015855.1|:58265-61345 Pseudomonas putida plasmid pGRT1, complete sequence
ATGGGACTTCTTGATAAGTGCGTGGATGCACTGGAAGGTACCTTGGAGTACCTCGCAAAACACTTCATTC
ACAAAGACATGACCAGTTACTGCGAACTGGCCACTGCTGTGGGGTTGACCGATGCCGACATCGAGAAATC
CCCGGATCTCAAAGATCCTTACACCTTGGTCAATAGCGATTACTCGCTGCTGACAGTATTCGATCTCCAA
GGTACCTACCAGATGCTCTCTGAAGCTGAGTTTTCAGAGATGCTGGAGTCGTTGCGTGTCCGCATGACTG
GCTATATGCGCGAGAAAGGGCATAGCCTCACGTTCAGCTTCGAGCGTGATCCGGAACGGGCCACCGATGA
ATTGATGCGTCTGGCCGAACCGCTACTGAACACTGCACGGCGCATCGGTTTGAAAAGCGAGGACATCATC
CTTGACCGCGTGAAGCGCAACGCTCCGCACTGTGCTTGGGAACAAAACCTGTTGGTTGTGTACACGCACC
TGACTTCGTTGAGTAACGAGGAACAGGATCGCGAGCTCGGCGAGCTGAGCAAGAAGGCATCAAAACACAA
GCTCCCGCGACTGGTTTACGGGCAGAACCCTGCATTTGCCCTTGCCGCTCTCAAATATCGGCATGACACG
ATGATTGAGCGACTCATGGATGACTTCATCTCGTGCGGGGTCGAGGGTAAGAAAGGCATCATGATGAAGC
CTCTAAGCGCCCACGAGGCGGCTAAGCGCATCAGGATCATGTTGAACCGCGAAGGTACTTCCCAGAAATT
CCGCCCTCAGATCGTGGGTGATCGCTTTATGTTTCGCGGGGCTACCGATGCAAAGGATTTCTCGGAACTT
GTGCCACCGCGGCTTAGCTATCAGATCTGCAGCAACGATGTGGAACCCGTAGGCAATTACGTCAAAACTG
ACAGCCTGTGGCACGGCTCGCTTGCGATGGAGCTTGGCCCACAAGACGTTGTGCACTTCACCAAACTGTT
TTCGGCCGTTGGCAAGAAGGACCCGTGGAGGATTCGATTCGATATCGCACCTGGCGGTCTTTCGATGATG
CGCGCCCGAAGATTGATGGTTGGTTTCGTCGGGGTTCTTCCAGACAACAGGGCTATTCGTGATTCCTTCA
AAAGTCTGGAGACCATCGCGAGGGATGAAGCCGTGATGTCTATGAAGATCATGGCTTCTTCTTGGAGTAC
CACAAAAGCGGACCTCGAGACACGACTTTCTCGACTGGAAAAAGCCATTCAATCCTGGGGTACCTGCCAA
GTTCAAAAAACGCATGGCGATCCCATGGCCGCACTTGCTTCTTCAATCCCTGGCTTTACCACCAAAAATA
CCGCTAACCGGCTTCTGCCCCCCCTCAAGGAAGCCATGAACATGTTGCCGCTTCAGCGGCCGGCAACCCC
GTGGCCCGACAATGGCTCGTGGATCACGAGAACACCAGACGGGAAGATTTACCCCATTGGCCTCGGCAGC
TCGATTCAGGATACCTGGATCGAGCTTGTCTCAGGCATCCCGGGCTCAGGTAAGTCAGTTGCAGCTAACT
GCATGCACAACGCAACTCTTCATCGTCCGGGTGCTACCCAGCTCCCCTTGCTGACGATTGTGGATGTTGG
TCCATCGTCCTCAGGCTTGATCCAGATGATCCAGGATTCGCTGCCAGATCATCGTAAGGCTGAAGCTGCG
TATCTCAGACTGCAGAACAGCCGCGATTTCGCGTCGAATCCATTTGACCCCCAGCTGGGGGCGCGTCAGC
CCACTCGCCGCGAGCGCGAATATTGCGTCGACTTCTTGAACTTGCTCTGTGCCAGCGTCGCCACCGATGG
CCAAGGCGGGGCAAAAGCCCGCACGCCATCCGACTGTGCCGCGGTCAACGAAATGCTGATGACCCTTGTA
TATGACGACAAAGCGGGGCGGGGAGCGAATCAGTATGAGCAGGATGTAGTGCCTGCGGTCGATAAGGTAC
TAGCCGAGTCGGGGATCAGCGCTGAGCATGATGAAAAGTGGTGGAGCGCTGCAACCTGGTACGAAGTGAC
TGACATGCTGTTCGCCGCTGGCTATGTGCGTGAAGCGACCTATGCACACCGCCAGGCTTCCCCTGTCCTG
CCCGACTTCACTGCCATGCTGAACAACGAAGGCGTGCGTCAAACCTTCGGAGAAATCAAAACCGCCGCAG
ACGAACCGCTGCTGAAATACATGGGCCGTTGCTTCACATTGGCATCGACTACCTACGCCGTTTTTTCCGG
TCGTACCCGATTTGAAGTCGACTCGACCACACGAGTCATTTCGGTGGACCTCAATGACGTGATTGGATCG
AAAACACCTGAGGGCTCGATCAAAACGTCCTGCATGTACATGTTTGCCCGCCACCTGGGGGCTAAGAACT
ACTTCTTGCGCGAAGAAGACATCCGTCTCGTAGCTCCGCCACTTTACCTCGATTACCACCTGAAACGTGC
TGAGGATGTGGCTTCGCAGCAGAAAACCATTGCTTATGACGAATGGCACAACACCGAGGGCATGGATACA
CCAGTGCAAACGCTGGTGAAGGACGGTCGCGAAGGCAGGAAATGGGGTATCCGAATCATGGTGATTTCCC
AGTATCTGCGCGACTTCCCACTTGCTCTGCTCAACGCGGCCACATCGGTCTACGTGTTGCGAGGCGGCAA
CGTGGATGATGAAAACGTGCTGCGCGAAACCTTCAAGGTATCGCACGAAACGATCCAGCAACTGCACCTG
CAGTGCACGGGTCCAGGGCGCAATGGCGCGAATATGCTTGCCCTGTTCAAGACGAACCAAGGCACGATCA
CCCAGATATTGACCAACACAACCGGGCCACTTGAGCTCTGGGCAATGTCCACTACCCAACAGGATACGGC
GCTGCGAACCGAGTTGTACAAGCGGATCGGTCCTATGGCTGCTCGCCAGGTTCTGGCCAAACGCTTCCCT
CTTGGCACCGCCAAGTCTCACATCGAAGCACTCGAATACGCGTCCACATCCAATGCCAAGCTGAGTGTTG
TGAAGCAACTGGCAGAGGATCTGGTTACCGCGTATTACGCCGAACAAAACCCCCGAGGAGAACACGCATG
A
 Primer design