SecReT4
Protein ID: 341583617
T4SS name [ID]VirB [508]
Gene symbol-
Locus tagRh054_02220
StrainRickettsia heilongjiangensis 054
Repliconchromosome [GenBank: NC_015866] [Browse all T4SS(s) in this replicon]
Location [Strand]391673..392371 [-]
ProductvirB8 protein
Component typeVirB8
UniProt IDG0GXH2
KEGG IDrhe:Rh054_02220
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-17, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|341583617|ref|YP_004764108.1| virB8 protein [Rickettsia heilongjiangensis 054]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLICININILLPINKKVSYL
IKDDAAKQATITNTKHSTLTNPYISIANIMLQNYVKQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSINNINYNEAVVTFESLAKNSTDAILENMVWEARVGFIMDSISTNTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|341583222|ref|NC_015866.1|:c392371-391673 Rickettsia heilongjiangensis 054 chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGTGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCATTAAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAATTTGTATAAATATCAATATATTGCTACCTATAAACAAAAAAGTAAGTTATTTA
ATAAAAGATGATGCCGCAAAACAAGCTACCATTACTAATACTAAACATTCAACATTAACAAATCCTTATA
TCTCTATTGCAAATATTATGCTTCAGAATTATGTAAAGCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAACAATATAAACTATAACGAGGCAGTTGTTACTTTTGAATCATTGGCAAAAAATAGTACGGATGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAGTCGGATTTATAATGGATTCTATCAGTACAAATACATCACCT
GATATGCCGTTCAATTTTACCGTCACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design