SecReT4
Protein ID: 341583619
T4SS name [ID]VirB [508]
Gene symbol-
Locus tagRh054_02230
StrainRickettsia heilongjiangensis 054
Repliconchromosome [GenBank: NC_015866] [Browse all T4SS(s) in this replicon]
Location [Strand]393064..393795 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDG0GXH4
KEGG IDrhe:Rh054_02230
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.2e-45, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|341583619|ref|YP_004764110.1| hypothetical protein Rh054_02230 [Rickettsia heilongjiangensis 054]
MNNIFGFFKSSNNSQIGSGDTQTQESIKLANPLKITQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|341583222|ref|NC_015866.1|:393064-393795 Rickettsia heilongjiangensis 054 chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAATCGGTTCAGGAGATACACAAACAC
AAGAAAGTATTAAATTGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACTATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTAAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCGGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCGACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCTGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design