SecReT4
Protein ID: 341583622
T4SS name [ID]VirB [508]
Gene symbol-
Locus tagRh054_02245
StrainRickettsia heilongjiangensis 054
Repliconchromosome [GenBank: NC_015866] [Browse all T4SS(s) in this replicon]
Location [Strand]395882..396886 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDG0GXH7
KEGG IDrhe:Rh054_02245
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-94, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|341583622|ref|YP_004764113.1| type IV secretion system ATPase VirB11 [Rickettsia heilongjiangensis 054]
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAKMGAFDDTATESLIDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEWMI
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|341583222|ref|NC_015866.1|:395882-396886 Rickettsia heilongjiangensis 054 chromosome, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCCGGAGAAGTATGGGTTGAAAAAAAAGGTGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAATAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCAAGCCATCCTAACAGAGTGCATTTA
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCAACACTGCATGCTGATAGTCCTGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAATATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGTGGATGATTTAA
 Primer design