SecReT4
Protein ID: 342162632
T4SS name [ID]Trw [150]
Gene symboltraG
Locus tagp271A_p02
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]1394..2395 [-]
ProductTraG
Component typeTrwD
UniProt IDG1CCV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.3e-51, Aligned region: 11..311
AAA_16 [PF13191], Evalue: 2.6e-05, Aligned region: 151..186
Protein Sequence: 333 a.a.     [Download]
>gi|342162632|ref|YP_004765013.1| TraG [Escherichia coli]
MNQSSAYYQLGPLREYFEDPGVFEVRINRYNEVVCDTFEGRKIIQNDSITGAFIDNLTAALTSANNVSRQ
MINDVVLPDGSRGIICLPPAVIDNTAAIAFRKNIALDKDLATLSQEGIFEFCREIDSHKRELDDDDLLLK
ELYRAKRREEFLLTAVRKKRTVVVVGETGSGKTVLTRALLKAISPQERVIIMEDAHEVEATHLEEAVYMK
YGGKDKPGLATPTQCLKACMRLTPDRIFMTELRDDAAWDYLQALNTGHPGGLTSTHANSAMDAFTRIGLM
VKATEVGRMLDISDIMRLLHSTIDVVVFMAKRKIREIYYSPEYKYECMNGGIK
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c2395-1394 Escherichia coli plasmid p271A, complete sequence
ATGAATCAATCATCGGCTTATTACCAGCTGGGGCCGCTGCGGGAGTATTTCGAAGATCCGGGCGTATTTG
AAGTCCGAATCAACCGTTATAACGAGGTGGTTTGTGACACATTCGAAGGCCGCAAAATCATCCAGAACGA
CAGCATTACCGGCGCGTTTATCGATAACCTGACTGCGGCATTAACCAGCGCCAATAACGTTTCGCGCCAG
ATGATTAATGACGTGGTGTTACCGGACGGTTCCAGGGGAATTATCTGTTTACCGCCTGCGGTGATCGATA
ACACCGCCGCTATCGCTTTTCGTAAAAATATCGCGCTGGATAAAGACCTGGCGACGTTAAGCCAGGAAGG
TATCTTTGAGTTTTGCCGGGAAATTGACAGCCATAAGCGCGAGCTGGACGACGACGATCTCCTGCTGAAA
GAGTTATACCGGGCTAAACGCCGGGAAGAATTTTTGCTTACTGCGGTACGGAAAAAGCGAACCGTTGTCG
TTGTGGGAGAAACCGGGTCAGGGAAAACGGTACTCACCCGCGCCCTGCTCAAAGCCATTAGCCCGCAGGA
ACGCGTGATAATCATGGAGGATGCTCACGAAGTTGAAGCTACCCACCTGGAAGAAGCCGTTTATATGAAA
TATGGCGGTAAAGATAAACCAGGGCTGGCTACGCCGACGCAGTGCCTTAAAGCCTGTATGCGCCTGACAC
CAGATCGTATCTTCATGACAGAGCTGAGGGATGATGCTGCATGGGATTACCTTCAGGCGTTGAATACCGG
ACACCCTGGCGGCTTAACCTCCACACATGCTAACTCGGCGATGGATGCCTTCACCCGTATAGGGTTGATG
GTTAAAGCTACCGAAGTGGGCCGTATGCTGGATATTTCTGACATTATGCGCCTGCTGCACTCCACTATTG
ATGTGGTCGTTTTCATGGCGAAAAGGAAGATTCGCGAAATCTACTATTCGCCAGAATATAAGTATGAGTG
CATGAATGGAGGGATAAAGTGA
 Primer design