SecReT4
Protein ID: 342162633
T4SS name [ID]Trw [150]
Gene symboltraF
Locus tagp271A_p03
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]2446..3585 [-]
ProductTraF
Component typeTrwE
UniProt IDG1CCV1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.4e-58, Aligned region: 194..370
Protein Sequence: 379 a.a.     [Download]
>gi|342162633|ref|YP_004765014.1| TraF [Escherichia coli]
MARKVDIDSELDNNSFDDERGGMPAQKRRTAPGLRAFIAILAIIAMCFVGVTIYTHTRKAPDTAKTDSGN
KNDGVSSLPSYQFNTNPNVGGAAAPAPDANRQAMQDKAKADYEASHNNAGRTNNGKKQLTPEEMAMQRRL
SGDLTGENGGGQTATKADQQQGDESSDGSSALAKQLTPARLKGTKAGVMQNMSMTIAKGTMIPCGMSTEL
DTTIPGMVSCRVTRDVYSVDGLVKLIDKGATVTGEMNGGLKNGQARVFVLWERAVNPDGTFINLDSAGTN
SLGSSGIPGQVDTHFWDRFSGAVFISVLSDALQAGVAAAQNGNNIQFSNTQNNSQELASEALRATINIPP
TLYDQQGDAISIYVVRDLDFSDIYSLADN
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c3585-2446 Escherichia coli plasmid p271A, complete sequence
ATGGCCCGTAAAGTCGATATTGATAGCGAGCTGGATAATAACAGCTTTGACGATGAGCGCGGGGGAATGC
CCGCACAAAAACGCCGTACCGCACCGGGGCTGAGAGCCTTTATTGCTATTCTGGCTATCATCGCTATGTG
CTTCGTTGGCGTCACAATCTACACGCACACACGAAAAGCCCCGGACACGGCCAAAACCGATAGCGGCAAT
AAAAACGATGGGGTTAGCAGCCTGCCTAGCTACCAGTTCAACACTAACCCGAACGTTGGCGGGGCTGCGG
CCCCGGCCCCGGACGCTAATCGCCAGGCGATGCAGGACAAAGCTAAAGCGGATTACGAGGCCAGCCATAA
TAACGCGGGCCGAACCAACAACGGGAAGAAGCAGCTGACGCCAGAAGAAATGGCGATGCAACGCCGCCTA
AGTGGCGATCTTACTGGCGAAAATGGCGGTGGTCAGACAGCTACAAAGGCTGACCAGCAGCAGGGCGATG
AAAGCAGTGACGGCAGCAGCGCGTTAGCTAAACAGCTGACGCCTGCCCGTCTCAAAGGTACTAAGGCAGG
TGTTATGCAGAATATGAGCATGACCATAGCCAAAGGGACGATGATACCGTGTGGAATGTCTACCGAGCTG
GACACAACCATTCCCGGTATGGTGTCCTGCCGCGTTACGCGTGATGTGTACTCCGTTGATGGGCTGGTGA
AACTTATCGATAAAGGGGCAACGGTTACAGGTGAAATGAATGGTGGCCTTAAAAACGGACAGGCGCGGGT
ATTTGTCCTGTGGGAACGGGCGGTAAACCCGGATGGGACATTCATTAACCTGGATAGCGCGGGGACAAAC
TCCCTCGGTAGTTCCGGCATCCCCGGACAGGTTGATACCCACTTTTGGGATCGTTTTTCCGGTGCGGTCT
TTATTTCCGTCCTGTCTGACGCGCTTCAGGCTGGCGTGGCCGCAGCTCAAAACGGCAATAATATCCAGTT
TAGTAATACGCAAAACAACTCGCAGGAACTGGCCTCTGAAGCACTGAGAGCCACGATTAACATCCCGCCA
ACACTCTACGACCAGCAGGGCGACGCAATCAGTATCTACGTCGTTCGTGACCTCGATTTCAGTGATATTT
ACTCACTGGCAGACAACTAA
 Primer design