SecReT4
Protein ID: 342162634
T4SS name [ID]Trw [150]
Gene symboltraO
Locus tagp271A_p04
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]3585..4472 [-]
ProductTraO
Component typeTrwF
UniProt IDG1CCV2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-48, Aligned region: 33..267
Protein Sequence: 295 a.a.     [Download]
>gi|342162634|ref|YP_004765015.1| TraO [Escherichia coli]
MKKIVLSAVITMALAGTAFNAAALDLPKSSPYDYRIKSVVYNPVDVVRIDAVAGLFTHIVVSPDETYITH
AFGDSDGWTFSHKLNHMFVKPKREMSDTNLTIVTDKRSYNIVLHYIGEAITKNADGTEEKSFIKTPWSMK
QATLQLTYEYPFEEQKKAASVAEKKRLTEKLRQSGFAGPKNYQYVMSDEPEMAEIQPIHVWDNYRFTRFE
FAENADLPQVTYISSSGKETVPNCRPVGENHNILECQNVAKEWRVRLGLTKVVGIKNINYVPAAGAVATG
TASPDVRRVQKGGDN
 
Nucleotide Sequence: 888 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c4472-3585 Escherichia coli plasmid p271A, complete sequence
ATGAAAAAGATAGTCTTATCCGCAGTGATCACAATGGCGCTGGCCGGGACCGCATTTAACGCAGCAGCGC
TGGATTTACCGAAAAGCTCACCATATGACTACCGCATAAAGTCGGTAGTCTATAACCCGGTTGATGTGGT
GAGAATTGACGCGGTAGCTGGTCTGTTTACTCATATAGTCGTTTCGCCGGACGAAACATACATCACTCAC
GCGTTTGGTGATTCTGATGGCTGGACGTTCTCGCATAAGCTCAATCATATGTTTGTAAAGCCTAAGCGCG
AAATGAGCGATACGAACCTGACTATCGTGACTGACAAACGGTCTTATAACATTGTGTTGCATTACATTGG
TGAAGCGATCACAAAGAATGCTGACGGTACAGAAGAAAAATCGTTTATCAAAACGCCCTGGTCAATGAAA
CAGGCCACGCTACAACTGACCTATGAGTATCCATTTGAGGAACAGAAAAAAGCAGCCAGCGTAGCGGAGA
AAAAACGGCTGACCGAAAAACTGCGTCAGTCTGGTTTTGCAGGCCCGAAAAATTACCAGTATGTGATGAG
TGACGAGCCGGAAATGGCAGAAATTCAACCGATCCACGTATGGGATAATTACCGTTTCACCCGCTTTGAG
TTCGCGGAAAATGCTGACTTACCACAGGTCACTTATATCTCGTCCAGTGGTAAAGAAACGGTCCCTAACT
GCCGTCCGGTTGGTGAGAACCACAATATCCTGGAGTGCCAGAACGTTGCAAAAGAATGGCGTGTGCGACT
TGGCTTAACAAAAGTAGTAGGTATCAAAAATATCAACTATGTGCCAGCAGCAGGCGCTGTTGCCACTGGC
ACAGCCTCCCCGGATGTAAGAAGGGTGCAAAAAGGAGGGGATAACTAA
 Primer design