SecReT4
Protein ID: 342162635
T4SS name [ID]Trw [150]
Gene symboltraE
Locus tagp271A_p05
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]4483..5178 [-]
ProductTraE
Component typeTrwG
UniProt IDG1CCV3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.7e-49, Aligned region: 23..229
Protein Sequence: 231 a.a.     [Download]
>gi|342162635|ref|YP_004765016.1| TraE [Escherichia coli]
MRVKKKGLTKEAIKEFNESRKGLEVDVMHEVLSSRRTAWIVAAAACVVAVVAIGNATYVNYRYSQPLPPF
LLTLNPATKEVSQVKLTRDEATYGDEIDKYFLTQYVIHRESYDFYSLQVDYDAVGLMSTSNVAESYLSKF
KGKQGIDKVLGDSEITRVTINSTILDKEHGVATIRFTTVRRARSNNFDDPPKHWIAILGYEYKALAMNAS
QRYVNPLGFRVTSYRVNPESN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c5178-4483 Escherichia coli plasmid p271A, complete sequence
ATGAGAGTGAAAAAGAAAGGGCTGACCAAAGAGGCCATCAAAGAGTTCAACGAAAGCCGTAAAGGGCTGG
AAGTGGACGTTATGCACGAGGTGCTATCTTCACGCCGCACGGCGTGGATAGTTGCTGCGGCCGCTTGCGT
TGTGGCAGTTGTGGCAATCGGTAACGCTACCTATGTGAATTATCGCTACAGCCAGCCGCTACCACCCTTT
TTGTTGACGCTGAACCCGGCCACTAAAGAGGTATCGCAGGTCAAGCTGACGCGTGACGAGGCCACCTATG
GCGACGAAATTGATAAGTATTTCCTGACTCAATACGTTATCCATCGTGAGTCCTACGATTTCTATTCCCT
GCAAGTGGACTATGACGCCGTAGGCTTAATGTCCACGTCAAATGTGGCTGAGTCCTATCTGTCCAAGTTC
AAGGGTAAGCAAGGGATTGATAAGGTCCTGGGTGACAGTGAAATAACCCGTGTAACCATTAACTCAACCA
TTCTCGATAAAGAACATGGTGTGGCAACCATTCGCTTTACGACCGTTCGTCGCGCACGTAGCAATAACTT
CGACGATCCGCCGAAGCACTGGATTGCCATCCTGGGCTATGAGTACAAAGCGCTGGCGATGAATGCTTCT
CAACGCTATGTAAACCCGCTCGGCTTCCGCGTCACCAGCTACCGCGTAAACCCTGAGTCGAACTGA
 Primer design