SecReT4
Protein ID: 342162636
T4SS name [ID]Trw [150]
Gene symboltraD
Locus tagp271A_p06
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]5397..6434 [-]
ProductTraD
Component typeTrwI
UniProt IDG1CCV4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-40, Aligned region: 40..268
Protein Sequence: 345 a.a.     [Download]
>gi|342162636|ref|YP_004765017.1| TraD [Escherichia coli]
MAFNTVQQIFDIIDDLINMMVDTNVTTIIATVTPTVAIFLTIKFMAQGAYSALSPGGGGEALGDLITQYM
KAAVVLSFATAGGLYQTDLVHLALTLPDNFASILVTQNKTSSTGMAAIIDTGVDQSITAIQTAFEGAGIS
ANGIMSAVIGLILIAATVVLCGLGSAFIIMAKVLLAISLCLGPIAIFCLLWNPTKGIFAKWMGTVINYSL
VIVLLALVFGLLMSLFTKMISGLNGSEGFDALSTAIGLVILTIVSVYVLFQVPAVASNFGSGVSADIASA
ARHAGHSMNTMGNVASNGIFGGAKPSARPSAAGGGGGQSASSSGNAGAGGSGLTGKARGSRGKAA
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c6434-5397 Escherichia coli plasmid p271A, complete sequence
ATGGCATTTAATACTGTTCAGCAGATATTTGACATAATTGATGATCTGATAAATATGATGGTTGATACCA
ACGTAACAACCATCATTGCAACCGTCACACCAACGGTTGCAATATTTTTGACCATCAAGTTTATGGCTCA
AGGTGCATATTCCGCTCTTAGCCCCGGAGGGGGCGGGGAGGCGCTTGGGGATTTAATTACACAATATATG
AAAGCGGCTGTTGTTTTGAGTTTTGCAACGGCTGGCGGGTTATATCAAACCGACCTTGTGCATTTGGCTT
TAACCCTGCCTGATAATTTTGCTTCAATATTGGTGACTCAAAATAAAACCTCAAGCACAGGGATGGCAGC
CATTATTGATACAGGGGTAGACCAGTCTATAACGGCAATACAAACAGCGTTCGAAGGGGCTGGCATTAGC
GCTAACGGCATAATGAGCGCAGTAATCGGACTCATTCTAATAGCAGCGACCGTAGTTCTTTGTGGGTTGG
GTTCTGCCTTTATAATTATGGCTAAAGTGCTACTGGCTATAAGCCTGTGTTTAGGTCCAATAGCTATATT
CTGTCTCCTGTGGAATCCAACAAAAGGCATATTTGCTAAGTGGATGGGGACCGTTATTAATTACAGCTTG
GTCATAGTTCTTTTGGCTCTCGTATTTGGGTTGTTAATGAGCCTCTTTACAAAAATGATTTCCGGTCTTA
ACGGCAGCGAAGGCTTTGATGCCTTATCAACGGCTATTGGACTGGTCATTCTCACCATTGTTTCCGTCTA
TGTGTTGTTCCAGGTTCCAGCGGTAGCGTCGAATTTCGGTAGCGGTGTTTCTGCTGATATAGCTTCTGCG
GCCCGCCATGCGGGCCACTCGATGAATACGATGGGTAATGTTGCCTCTAATGGGATTTTTGGTGGAGCGA
AGCCTTCAGCAAGACCTTCAGCAGCTGGCGGCGGCGGTGGACAAAGCGCCAGCAGTAGCGGCAATGCAGG
GGCTGGCGGTTCAGGTCTGACAGGAAAGGCGCGTGGTAGCCGGGGAAAAGCAGCATAA
 Primer design