SecReT4
Protein ID: 342162638
T4SS name [ID]Trw [150]
Gene symboltraC
Locus tagp271A_p08
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]6703..7404 [-]
ProductTraC
Component typeTrwJ
UniProt IDG1CCV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.9e-43, Aligned region: 32..212
Protein Sequence: 233 a.a.     [Download]
>gi|342162638|ref|YP_004765019.1| TraC [Escherichia coli]
MKAKLIAIALAGLLGAGTIGTASAIEGTGVVVYDPTGVAKMLDQIEQLKQQLATQEATYKSLTKTTDIGN
LLGSSTSALAKNLPDDWKKVYSDAMNSSSSVTGDVQSMVGDFNSEVDDMNPSDAIKALNKKLAEKGAYDR
VIAEKAYNNQMQELSDMQALTEQISTTKDVKEVADLQARIQTAQGAIQGEQAKLKLMSMLQESQDKLYEA
QRERAVGNFIYGSDGGHNPAPLK
 
Nucleotide Sequence: 702 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c7404-6703 Escherichia coli plasmid p271A, complete sequence
ATGAAAGCGAAGTTAATTGCTATTGCACTGGCTGGGCTGTTAGGTGCGGGAACCATTGGTACGGCTTCTG
CTATAGAGGGTACTGGTGTTGTGGTCTACGATCCGACTGGCGTGGCTAAAATGCTTGACCAAATAGAACA
GTTAAAGCAACAACTGGCAACCCAAGAGGCGACTTATAAAAGTCTGACAAAAACTACTGATATTGGGAAT
TTGTTGGGTTCGTCTACAAGTGCCCTCGCTAAAAATCTTCCTGACGACTGGAAGAAAGTTTATAGCGATG
CCATGAACTCATCATCGTCCGTAACTGGTGATGTTCAAAGTATGGTTGGTGACTTTAATTCGGAAGTTGA
TGATATGAATCCTTCTGATGCAATTAAAGCTCTAAATAAAAAGTTGGCCGAGAAAGGAGCATATGACCGT
GTTATAGCTGAAAAGGCATATAACAATCAGATGCAGGAATTAAGTGATATGCAAGCACTAACCGAGCAGA
TTTCCACAACTAAAGATGTAAAGGAAGTTGCTGATCTTCAGGCTCGCATTCAAACCGCGCAAGGCGCAAT
TCAGGGCGAGCAAGCGAAACTGAAGCTCATGAGTATGCTTCAGGAATCACAAGATAAGTTGTATGAAGCT
CAAAGAGAACGCGCCGTAGGTAATTTTATTTATGGTTCTGATGGTGGTCATAACCCCGCTCCGTTGAAAT
AA
 Primer design