SecReT4
Protein ID: 342162639
T4SS name [ID]Trw [150]
Gene symboltraB
Locus tagp271A_p09
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]7420..9993 [-]
ProductTraB
Component typeTrwK
UniProt IDG1CCV7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.2e-54, Aligned region: 227..424
AAA_10 [PF12846], Evalue: 4.8e-28, Aligned region: 487..764
Protein Sequence: 857 a.a.     [Download]
>gi|342162639|ref|YP_004765020.1| TraB [Escherichia coli]
MVALLKPKTFRDEPSVNEKYLQHSQHLDDYIISMRNGDLLAFFKVDGRTHDCASDRELITWNDDLNTLIK
SFGTDHVEVWSHEYHHQSKEYPDSEFTQFFPRYLDEYNRRLQTGSNQMVNDLYLTVLYRQIGDKTQKFLA
KFERPSADELAQMQAEAFTGMEEVCEQIMEGMKGYGIKRLGIYYRDKNGEEIALTDAEEKQSLLEVDEAD
IFDEPVMLNVADTVPPTAHAYSKALEFLYFLVNLEWSIVPVCRDRIGSYIMENRVVSSVWGDIVQVRTLD
SNFYTTAIEIRDYEKNTEPGQFNLLKEADFEYLLTQTFSCISEASAKTLLERQEKSMMETGDRSQSQLEQ
LNTALDMLLSKEIVMGYHHATIHVFDTDQRAVQRKARKAKVMLSQCGFVGGGVGLASEAAYFAKIPGNQK
WAPRPTPINSWNFFHFSPYHNFMRGKPDNNPWGPAVTMFRTANGTPLYFNFHVTPLEERSIGKRPLGHML
LTGTSGEGKTTLLDFLLCQCMKFNPRMFCYDRDRGMEPFIRSVGGYYKVLQQGVKTNFSPLKQKGTPRNI
ATTKNIMRVCAEITNNGPLDKDMGMELNKAVDAVMGEHSLIPVEARDITRLKGYITHPYLKDLINDWTND
GQYGWLFDNGEDALDLDAHDIFGFDLTEFIAAEGEIPSPARTPLLMYLLYRIRNSIDGKRRVIQCFDEFH
AYLDDPVLKLEIKRGIKTDRKKDAIYLFSTQEPNDALASSIGKTVMSQTPSKICLRDPDASRKDYSFLTD
AEFEVMSKIPEHSRQFLVKQGSQSALATFNLNINGSNTPERDEIEKNNIISILSGEPQNAELAEELIEKY
GPEPENWIEEYWRLCRH
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c9993-7420 Escherichia coli plasmid p271A, complete sequence
ATGGTGGCATTGCTTAAACCTAAAACGTTCAGAGACGAGCCGAGCGTTAATGAAAAGTATTTGCAGCATA
GCCAGCACCTTGATGATTATATTATCTCGATGCGTAATGGCGATCTGCTTGCATTCTTTAAAGTCGATGG
CCGGACACATGACTGTGCCTCTGACCGTGAGCTGATTACATGGAACGATGATCTTAATACGTTGATTAAA
TCCTTCGGGACTGACCACGTAGAGGTCTGGTCACACGAGTATCATCACCAGTCTAAAGAGTATCCTGATT
CTGAGTTTACTCAATTCTTCCCACGCTACCTGGATGAATACAACCGCCGCCTGCAAACGGGGTCTAACCA
GATGGTTAATGACCTGTACCTGACGGTGCTTTATCGCCAGATAGGCGATAAGACGCAGAAGTTCCTGGCT
AAGTTTGAGCGACCGTCAGCTGACGAGTTGGCTCAAATGCAGGCTGAAGCCTTCACCGGAATGGAAGAAG
TCTGTGAGCAGATCATGGAGGGGATGAAGGGCTATGGCATCAAGCGCCTGGGTATTTATTACCGGGATAA
AAACGGTGAGGAAATAGCGCTAACTGACGCTGAAGAAAAACAGTCGCTGCTTGAAGTAGACGAAGCAGAT
ATTTTCGACGAACCGGTAATGCTCAACGTCGCTGATACCGTCCCGCCGACTGCTCACGCTTATTCTAAAG
CGCTGGAGTTTCTTTATTTTCTGGTAAATCTGGAATGGTCCATTGTTCCTGTTTGCCGTGACCGTATCGG
TTCTTACATCATGGAAAACCGTGTTGTCAGTTCTGTATGGGGGGATATTGTTCAGGTCAGAACGCTGGAC
AGCAATTTTTATACTACAGCTATCGAAATCCGTGATTACGAAAAAAACACGGAACCGGGTCAGTTTAATT
TGCTGAAAGAAGCTGATTTTGAATATCTGCTGACTCAAACATTTTCTTGCATATCCGAGGCTTCAGCTAA
AACGCTTCTGGAGCGCCAGGAGAAGTCCATGATGGAAACTGGCGACAGAAGCCAGTCCCAGCTTGAACAG
TTGAATACAGCGCTGGATATGCTGCTTTCTAAAGAAATTGTGATGGGCTATCACCATGCCACTATTCACG
TTTTCGATACCGATCAGCGAGCAGTGCAGCGCAAGGCCCGTAAAGCTAAAGTCATGCTAAGTCAGTGTGG
CTTCGTGGGGGGCGGCGTAGGGCTGGCCTCTGAAGCGGCTTACTTTGCGAAGATTCCGGGTAATCAGAAA
TGGGCGCCACGCCCGACGCCGATTAACTCATGGAATTTCTTCCATTTCTCCCCGTACCATAATTTTATGC
GCGGCAAACCGGACAATAATCCGTGGGGTCCGGCTGTGACGATGTTCCGCACCGCGAACGGTACACCGCT
GTATTTTAACTTCCACGTCACCCCACTGGAAGAACGCTCAATCGGAAAGCGCCCGCTGGGGCATATGTTG
CTTACAGGTACGTCTGGTGAAGGTAAAACTACGCTGCTGGATTTCCTGTTATGCCAGTGCATGAAGTTTA
ATCCGCGTATGTTCTGCTATGACCGTGACCGGGGAATGGAGCCGTTTATTCGCAGTGTCGGCGGCTACTA
TAAAGTTTTACAGCAGGGCGTAAAAACTAACTTCTCACCGCTCAAACAGAAAGGCACACCGCGTAATATT
GCGACCACTAAAAATATTATGCGTGTCTGTGCTGAAATTACAAATAACGGCCCATTAGATAAAGATATGG
GGATGGAACTCAATAAGGCTGTGGATGCTGTCATGGGCGAACACTCTTTAATCCCTGTTGAGGCCAGAGA
TATTACCCGACTGAAAGGGTACATCACGCACCCATATCTCAAAGACCTGATTAATGACTGGACGAATGAC
GGCCAATACGGCTGGCTTTTTGATAATGGTGAAGATGCGTTAGATCTCGATGCTCATGATATTTTCGGCT
TCGACCTGACGGAGTTTATTGCTGCGGAAGGTGAGATTCCCAGCCCGGCCAGAACGCCATTGTTAATGTA
CTTGCTTTATCGTATTCGTAATTCAATTGACGGAAAGCGCCGTGTTATTCAGTGTTTCGATGAATTTCAC
GCTTATCTTGACGATCCTGTTTTAAAGCTGGAAATAAAGCGCGGCATTAAAACAGACCGTAAGAAAGATG
CGATTTATTTGTTTTCCACGCAAGAGCCAAATGACGCGCTCGCAAGCAGCATTGGTAAAACGGTGATGTC
GCAAACGCCATCAAAAATCTGCCTGCGCGATCCTGATGCCAGCCGTAAGGACTACTCCTTCCTGACCGAT
GCGGAGTTTGAAGTAATGTCCAAAATCCCTGAGCACTCGCGCCAGTTTTTGGTTAAGCAAGGGTCACAGT
CAGCGCTCGCTACATTCAACCTGAATATCAACGGTAGTAATACGCCTGAACGGGATGAAATCGAGAAGAA
CAACATTATCAGCATTCTTTCCGGGGAGCCGCAGAATGCTGAACTGGCTGAAGAATTGATAGAGAAATAC
GGTCCAGAACCGGAAAACTGGATTGAGGAATACTGGCGTCTTTGCCGTCATTAA
 Primer design