SecReT4
Protein ID: 342162640
T4SS name [ID]Trw [150]
Gene symboltraA
Locus tagp271A_p10
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]9994..10311 [-]
ProductTraA
Component typeTrwM
UniProt IDG1CCV8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.8e-21, Aligned region: 1..81
Protein Sequence: 105 a.a.     [Download]
>gi|342162640|ref|YP_004765021.1| TraA [Escherichia coli]
MFENGQRPLFKGATRVPRLAGVPRTVALVIFMISATLFMTLHLWSLLVFAVLWSIAAALTKYDDRMFRIL
SLWLQTKFRNAHDTPFKQWSGSSYSPVDYKKKELK
 
Nucleotide Sequence: 318 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c10311-9994 Escherichia coli plasmid p271A, complete sequence
ATGTTTGAAAATGGACAACGGCCATTATTTAAAGGTGCAACACGCGTCCCCCGGCTTGCTGGCGTTCCGC
GTACTGTGGCGCTGGTTATCTTCATGATCTCGGCCACGCTGTTTATGACGTTACATTTATGGTCACTCCT
TGTATTTGCGGTTCTGTGGTCAATTGCAGCAGCGCTAACTAAATACGACGACCGTATGTTTCGCATCCTT
TCATTATGGCTACAGACTAAGTTTCGTAATGCACACGACACGCCATTTAAACAATGGAGTGGTTCAAGTT
ATTCCCCTGTGGATTACAAGAAAAAGGAGCTGAAATAA
 Primer design