SecReT4
Protein ID: 342162642
T4SS name [ID]Trw [150]
Gene symboltraL
Locus tagp271A_p12
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]10894..11676 [-]
ProductTraL
Component typeTrwN
UniProt IDG1CCW0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.9e-28, Aligned region: 32..178
Protein Sequence: 260 a.a.     [Download]
>gi|342162642|ref|YP_004765023.1| TraL [Escherichia coli]
MKKSWCLIAVCISGLSFQGVAHAASASDTIASLAARCAPDVSPLTMAYIVGHESGNNPYFINVNRGANLK
RQPQTEAEAVEVANRLIKNLKKDESIDMGLAMINSNNLSSLGITVEQVFKPCINLRASQTILKDCYSTAL
KSNPPGQIALRHALSCYNTGSQVRGISNGYVTKVINVAKQSDLKIPTLLPDGQNEEAESQPVSAKGATFE
GEHDAFTGESDSGGDVFSQDNTDAFLTKAEQKGSEVMNDKNLSPVAVSNN
 
Nucleotide Sequence: 783 bp     [Download]
>gi|342162630|ref|NC_015872.1|:c11676-10894 Escherichia coli plasmid p271A, complete sequence
ATGAAAAAATCATGGTGCTTGATAGCGGTATGTATCTCCGGCCTTTCTTTTCAGGGGGTCGCTCACGCGG
CTTCTGCCTCGGATACGATCGCCAGCCTTGCTGCCCGATGCGCACCAGACGTTTCACCGCTGACAATGGC
CTATATCGTCGGCCATGAATCCGGGAACAACCCGTATTTTATTAACGTTAACCGTGGCGCAAACCTGAAA
CGCCAACCGCAAACCGAAGCTGAAGCGGTAGAAGTTGCCAACCGGCTAATCAAAAACCTCAAGAAAGATG
AAAGCATCGATATGGGGCTTGCGATGATTAATTCTAACAATTTGAGTTCGTTAGGTATCACGGTTGAGCA
GGTATTTAAACCCTGCATCAATCTCCGCGCCAGTCAGACCATTTTAAAAGACTGTTATAGTACGGCCCTG
AAATCCAACCCGCCCGGCCAGATAGCATTAAGACACGCGCTGTCCTGCTACAACACCGGGTCGCAAGTGC
GGGGGATTTCAAACGGGTATGTCACGAAAGTAATTAACGTGGCTAAACAGTCTGATTTAAAGATCCCTAC
GTTGCTACCTGATGGGCAGAACGAGGAAGCGGAGAGCCAGCCTGTGAGTGCGAAGGGCGCAACCTTTGAG
GGTGAGCACGATGCGTTTACGGGTGAAAGTGATAGTGGTGGTGATGTGTTTTCGCAGGATAACACTGACG
CGTTTCTGACCAAAGCAGAGCAAAAAGGGAGTGAGGTTATGAATGACAAAAATCTATCTCCTGTTGCAGT
CTCAAATAATTGA
 Primer design