SecReT4
Protein ID: 342162659
T4SS name [ID]Trw [150]
Gene symboltraJ
Locus tagp271A_p29
StrainEscherichia coli plasmid p271A (NC_015872)
Repliconplasmid p271A [GenBank: NC_015872] [Browse all T4SS(s) in this replicon]
Location [Strand]21704..23236 [+]
ProductTraJ
Component typeTrwB
UniProt IDG1CCX7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.9e-108, Aligned region: 112..493
TraG-D_C [PF12696], Evalue: 3.8e-18, Aligned region: 352..474
T4SS-DNA_transf [PF02534], Evalue: 3.2e-12, Aligned region: 302..488
AAA_10 [PF12846], Evalue: 3.2e-11, Aligned region: 128..170
AAA_10 [PF12846], Evalue: 3.2e-11, Aligned region: 344..430
DUF87 [PF01935], Evalue: 5.4e-08, Aligned region: 118..181
Protein Sequence: 510 a.a.     [Download]
>gi|342162659|ref|YP_004765040.1| TraJ [Escherichia coli]
MTEQERGLIFLCSLLGPIPFVWFITAKFVYGINSETAHYLVPYLLKNTFNLWPLWVAIIAGAVIGLCGFI
GFIIYDKGRVYKGPRFKRVLRGTKLVRASSLAERTKERGHKQLTVAGVPVPTEYETLHFSIGGATGTGKS
TIIKEAIYSSLKRGRDKRVILDPNGEYVETFYRENDIILNPYDKRSPGWSMFNEIRDEFDYDLYAVSIIQ
ESKERSAEEWYRYGRLLYREVSKKLLTHKRNPSMEEVLYWCNVAEYDKVKDFVKGTPAESLFIKGAERAT
GSARFVLGDKLASHLKMPEGNFSLRDWLEDDKPGTLFITWQEQMKKSLNPLISCWLDIMFSSLLGMGKRD
QRTLFFIDELESLEYLPNLQDLLTKGRKSGASVWAGYQTFSQLVERYGINIAETLLGSMRSGIVMGSSRL
GKATLEHMSRALGEIEGEIERRQGGILQSGPNNRPRIETRTVRAVTPTEISELRNLTGYIYFPGDLPVGK
FKTKHVQYTRKNPVPGIIMR
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|342162630|ref|NC_015872.1|:21704-23236 Escherichia coli plasmid p271A, complete sequence
ATGACGGAACAAGAAAGAGGACTTATATTTTTATGCTCATTGCTGGGACCGATACCCTTTGTGTGGTTTA
TTACTGCAAAGTTTGTTTATGGTATTAATAGCGAGACGGCTCACTACCTTGTCCCCTATTTGTTAAAAAA
CACGTTCAACCTGTGGCCGTTATGGGTGGCGATTATTGCAGGGGCAGTTATAGGTTTGTGTGGCTTTATA
GGATTCATCATTTACGATAAAGGTAGGGTGTATAAAGGACCGCGATTTAAGCGTGTACTCCGTGGCACTA
AATTAGTTAGAGCTTCATCTTTAGCAGAGAGAACAAAAGAACGTGGTCATAAGCAATTAACTGTTGCAGG
TGTTCCCGTGCCTACTGAATATGAAACGCTTCATTTTTCAATCGGTGGAGCTACAGGTACGGGTAAATCG
ACAATCATTAAAGAAGCGATATATTCAAGTTTAAAAAGAGGGCGGGATAAACGAGTTATCTTAGATCCTA
ATGGAGAGTATGTGGAAACTTTTTATCGTGAGAACGATATAATTCTTAACCCCTATGATAAACGCTCTCC
AGGCTGGTCGATGTTTAATGAGATAAGGGATGAGTTTGACTACGATCTTTATGCTGTGTCTATTATTCAG
GAAAGCAAGGAGCGTTCTGCTGAAGAATGGTATCGATATGGACGCTTATTATATCGTGAGGTTTCAAAGA
AATTACTTACACATAAAAGAAACCCTTCAATGGAAGAAGTGTTGTATTGGTGTAACGTTGCAGAATACGA
CAAAGTGAAGGATTTTGTTAAAGGCACGCCCGCAGAATCTTTATTCATTAAAGGTGCAGAAAGAGCTACA
GGGAGTGCCAGATTTGTTTTAGGTGATAAGCTAGCTTCCCATTTGAAAATGCCTGAAGGGAATTTCTCGC
TGCGTGACTGGCTGGAGGATGATAAACCCGGCACGCTGTTTATCACCTGGCAAGAGCAGATGAAAAAGAG
TCTCAACCCGCTGATTTCATGCTGGCTGGATATTATGTTTTCAAGCCTGCTGGGTATGGGGAAACGCGAT
CAGCGCACGTTATTTTTCATCGACGAACTGGAATCACTGGAATACCTGCCAAACCTACAGGACTTACTGA
CGAAGGGCCGTAAAAGCGGCGCGTCAGTATGGGCTGGCTACCAGACGTTTTCCCAGTTGGTGGAACGTTA
TGGCATCAATATAGCTGAAACGTTATTGGGTAGTATGCGATCTGGTATCGTCATGGGAAGCAGTCGATTA
GGTAAAGCAACGCTTGAACATATGTCCCGCGCATTGGGCGAAATAGAAGGAGAAATAGAGCGCAGACAAG
GGGGCATATTACAGTCTGGCCCAAATAATAGGCCGCGAATCGAAACTCGTACAGTCAGAGCAGTAACCCC
CACTGAAATCTCAGAACTCAGGAATCTTACGGGCTATATCTATTTCCCTGGTGATCTACCTGTCGGCAAG
TTCAAGACTAAACATGTGCAATACACGCGTAAGAACCCGGTTCCGGGCATCATCATGAGGTAG
 Primer design