SecReT4
Protein ID: 342162950
T4SS name [ID]Tra_Tn [644]
Gene symbol-
Locus tagSPPN_01425
StrainStreptococcus pseudopneumoniae IS7493
Repliconchromosome [GenBank: NC_015875] [Browse all T4SS(s) in this replicon]
Location [Strand]225433..226818 [+]
Productcell division FtsK/SpoIIIE protein
Component typeOrf21_Tn
UniProt IDG0IBF4
KEGG IDstd:SPPN_01425
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.5e-41, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 4.4e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 222..340
Protein Sequence: 461 a.a.     [Download]
>gi|342162950|ref|YP_004767589.1| cell division FtsK/SpoIIIE protein [Streptococcus pseudopneumoniae IS7493]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|342162671|ref|NC_015875.1|:225433-226818 Streptococcus pseudopneumoniae IS7493 chromosome, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCTGGTAAAGATTTAGTCTTTCATTTTACGATAGCGTCAC
TCCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTTAACCTATCACAAGCAGATAAGATTGACATTCCCTATTTAATTATCAGTTTCAGTGTCGCAATTCTT
ATCTGCTTGCTGGTAGCGTTTGTATTCAAACGGGTTCGCTATGATACGGTTAAACAACTTTACCACCGTC
AAAAACTGGCAAAGATGATACTTGAAAACAAGTGGTATGAATCTGAACAGGTCAAAACAGAGGGTTTCTT
TAAAGATAGTGCTGGTCGTACAAAGGAAAAGATAACCTACTTCCCTAAAATGTATTATCGACTTAAAAAT
GGCTTGATACAGATACGGGTGGAAATCACGCTGGGAAAATATCAAGACCAACTCTTACACTTGGAAAAGA
AATTAGAGAGTGGCTTGTACTGTGAGCTGACGGATAAAGAGTTAAAGGATTCCTATGTGGAATATACTTT
GCTCTATGACACCATAGCCAGTCGTATTTCTATTGATGAAGTAGAAGCTAAAGATGGTAAACTTCGCTTA
ATGAAAAACGTATGGTGGGAATATGATAAGCTCCCTCATATGTTGATTGCTGGTGGTACAGGTGGCGGTA
AAACTTACTTTATACTGACACTGATTGAAGCCTTGCTTCATACAGATTCAAAACTGTATATTCTTGACCC
GAAAAATGCTGATCTTGCGGACTTAGGTTCTGTGATGGCAAATGTCTACTATAGAAAAGAAGACTTGCTT
TCTTGCATTGAAACATTCTATGAAGAAATGATGAAACGTAGTGAGGAAATGAAGCAGATGAAGAACTATA
AGACTGGCAAAAATTATGCTTACTTAGGTCTCCCGGCACACTTCTTAATCTTTGATGAATACGTCGCTTT
CATGGAAATGCTGGGAACAAAAGAAAACACCGCAGTTATGAATAAGCTGAAACAGATTGTCATGTTAGGT
CGTCAAGCTGGCTTCTTTCTAATACTGGCTTGTCAACGTCCAGACGCAAAATATTTAGGCGACGGAATCC
GTGATCAGTTTAATTTCAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGCAG
TGACGTACAAAAGGATTTCTTCTTAAAGCGAATCAAAGGTCGTGGCTATGTTGATGTAGGAACAAGTGTC
ATATCAGAGTTTTATACTCCCCTTGTACCAAAAGGATATGATTTCTTGGAGGAAATTAAAAAGTTATCCA
ACAGCAGACAGTCCACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTGA
 Primer design