SecReT4
Protein ID: 342162952
T4SS name [ID]Tra_Tn [644]
Gene symbol-
Locus tagSPPN_01435
StrainStreptococcus pseudopneumoniae IS7493
Repliconchromosome [GenBank: NC_015875] [Browse all T4SS(s) in this replicon]
Location [Strand]228244..228465 [+]
ProductTn916 ORF19 protein
Component typeOrf19_Tn
UniProt IDG0IBF6
KEGG IDstd:SPPN_01435
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|342162952|ref|YP_004767591.1| Tn916 ORF19 protein [Streptococcus pseudopneumoniae IS7493]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|342162671|ref|NC_015875.1|:228244-228465 Streptococcus pseudopneumoniae IS7493 chromosome, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCGTGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTACTAGAGCTATTCAATCGCATT
ATTGGTGCTTAA
 Primer design