SecReT4
Protein ID: 342162954
T4SS name [ID]Tra_Tn [644]
Gene symbol-
Locus tagSPPN_01445
StrainStreptococcus pseudopneumoniae IS7493
Repliconchromosome [GenBank: NC_015875] [Browse all T4SS(s) in this replicon]
Location [Strand]229054..229560 [+]
ProductTn916 ORF17 signal peptide containing protein
Component typeOrf17_Tn
UniProt IDG0IBF8
KEGG IDstd:SPPN_01445
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 2.6e-34, Aligned region: 44..145
Protein Sequence: 168 a.a.     [Download]
>gi|342162954|ref|YP_004767593.1| Tn916 ORF17 signal peptide containing protein [Streptococcus pseudopneumoniae IS7493]
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFT
QMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTY
AGKKVTLGRNQPQEAITAVRSEFYGISN
 
Nucleotide Sequence: 507 bp     [Download]
>gi|342162671|ref|NC_015875.1|:229054-229560 Streptococcus pseudopneumoniae IS7493 chromosome, complete genome
ATGGGATTTTTGAAATCGTCTATTAAATCTGTCGGTACATTACTACTGGCAGATTTTCTATTTTACGGGG
TGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCAG
TATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTACG
CAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATGA
TAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTTT
TGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTAT
GCAGGAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTT
ATGGCATATCCAATTAA
 Primer design