SecReT4
Protein ID: 342162958
T4SS name [ID]Tra_Tn [644]
Gene symbol-
Locus tagSPPN_01465
StrainStreptococcus pseudopneumoniae IS7493
Repliconchromosome [GenBank: NC_015875] [Browse all T4SS(s) in this replicon]
Location [Strand]235166..236101 [+]
ProductTn916 ORF13 protein
Component typeOrf13_Tn
UniProt IDG0IBG2
KEGG IDstd:SPPN_01465
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1e-62, Aligned region: 84..310
Protein Sequence: 311 a.a.     [Download]
>gi|342162958|ref|YP_004767597.1| Tn916 ORF13 protein [Streptococcus pseudopneumoniae IS7493]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETT
IIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQ
IWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIE
SEGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLT
VEYIDQQTKATQVSQFDLVLEKNGSNWKIIE
 
Nucleotide Sequence: 936 bp     [Download]
>gi|342162671|ref|NC_015875.1|:235166-236101 Streptococcus pseudopneumoniae IS7493 chromosome, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTACTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGG
GCTTAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACT
ATCATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACT
ATTCATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGA
ACTTCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAG
ATATGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAG
AGGGAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATAT
GGTACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAA
AGTGAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCT
ATCCTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGA
GTACATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACA
GTGGAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACG
GGAGTAATTGGAAGATTATAGAATAA
 Primer design