SecReT4
Protein ID: 344201045
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_2971
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2915918..2919280 [-]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDG0JTT0
KEGG IDafi:Acife_2971
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.8e-23, Aligned region: 33..137
TraG_N [PF07916], Evalue: 5.8e-23, Aligned region: 236..500
Protein Sequence: 1120 a.a.     [Download]
>gi|344201045|ref|YP_004785371.1| TraG domain-containing protein [Acidithiobacillus ferrivorans SS3]
MVPNIYVVGNLNSFFSALTALQMLFNPANNTLWAGNNGAFGGGALIALGLVITLIILFVTSMLKQRFEMH
QVLLLAVFFAVMFAVKTPVNLENMYNGDSSIVDGVPIGVAYTASIFSTVSYEASKEIGQAFQQANNTDTS
LFTGSNGNGGVYGFDGPLALTYKLRGLYSLFSMKQAPMSNSVSSFVASCIEPTSDVSQGEIGTAGSLTCA
FFGLNCTTGQQLPLANAEATLYVNSADQPKPGYTVPCSTASQTLASAWSDFQNGTTSAGVPNFNDLLQEK
TTGSSLNGQTPASASMMVGTMLQGTANTGYDYMNNMILNCAFQSGEHVGLSVYDPNMPTALDPYCVTKAT
AFGRQAAMNAGTASLFGMNMLPLMAILQFLFFAMTPIVIGVVMMQGMAGLSNFGKFLLFGAWTESWMPVA
ALINDYSQEIIGESFKKMEAHMHGVPMTSPSNIGMILDHAQRNLSMANLMMGLTPVLTFAILSGSYYGFS
QLGTAIRGDSVMDKNMSESTPTAGASTLAGNTSERTLASTGNGRTFETGTALNGLSYDLSQKVSSGLSAA
NTSAVQMSNAATASASRVGEQTASYLRNAQTAVASGTALSSGANDTVSTMSSAQKTLSTMTGLSEAQATT
FAARLTGELGGNLNANGISEGMVAKALSGFDIGGKAAAEEAARITGEMKTSAGLQAASTLTNSNNLSKLS
GINSSLTHSSSVGTSANLGMSAKKAWQEGASANAAMSQAEQLQHLSSIVQGQGGSQTFNAENLGAALEQN
AKRIGLSSHSYANDIADRNGLQANFQKGVADAERQGIRGTEAAAFGLVYAANRAPNAAAGASAITEAAGI
SPFRAQSQGLGNAVRGQISNNAAQTDAGGNAAAISGAKAQIAATNAATGGAPTPGKVQAEYDAGQGEAAA
AIGGNNGAGDYNATAGNQFAAQYKASHPKDFQSPTSVGSGNSQVTVGANGQLGGSTVGTVGKQNDNVLMN
GVPTPIGTIPIGAKQMAAHPDDTAAAISGTIAGAGALKGAAAIYGAKKAADIAEQKALQKSIDSGETGSG
DGFDVNGKPLPKEATPPRTPDGSSDTMSRLTGRPSIKSSEQQLDDTLKPLREIDPNLGAGGDAFDDVPFE
 
Nucleotide Sequence: 3363 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2919280-2915918 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
GTGGTTCCAAATATCTATGTCGTAGGCAATCTGAACAGTTTTTTTTCGGCGCTGACCGCGCTGCAGATGC
TCTTCAATCCGGCAAACAACACCCTTTGGGCGGGGAATAACGGAGCATTCGGTGGCGGTGCTCTGATTGC
TCTGGGACTCGTGATTACCCTCATCATTCTTTTTGTCACATCCATGCTAAAACAGCGATTCGAGATGCAC
CAGGTCCTCCTCCTGGCGGTGTTCTTCGCCGTCATGTTCGCTGTCAAAACCCCGGTCAACCTGGAAAATA
TGTATAACGGCGATTCCAGTATCGTCGATGGGGTACCCATAGGGGTTGCCTATACCGCGTCGATCTTCTC
TACGGTTTCCTATGAGGCTAGCAAGGAAATCGGCCAGGCCTTTCAGCAGGCAAACAATACGGATACCAGC
CTGTTTACCGGCTCTAATGGCAATGGTGGTGTCTACGGGTTCGATGGGCCATTGGCACTGACTTACAAAT
TGCGCGGTTTATACAGTCTTTTTTCCATGAAGCAAGCACCAATGAGCAATTCGGTAAGCAGCTTTGTCGC
TTCCTGTATCGAACCTACCAGCGATGTTTCACAAGGGGAAATAGGCACGGCGGGAAGCCTTACCTGCGCT
TTCTTTGGCCTGAATTGTACAACTGGTCAACAGCTCCCTCTGGCTAATGCCGAAGCCACGCTGTATGTGA
ACAGCGCAGATCAACCCAAACCTGGGTACACCGTACCCTGCAGTACCGCATCACAGACTTTGGCAAGTGC
CTGGTCTGACTTCCAGAATGGCACCACCAGTGCCGGTGTCCCGAATTTTAATGATTTGCTACAGGAAAAG
ACGACCGGATCCAGTCTGAACGGGCAGACACCAGCGTCGGCCAGTATGATGGTCGGCACCATGCTCCAGG
GTACGGCCAATACCGGCTACGACTACATGAACAACATGATCCTGAATTGCGCCTTCCAGAGTGGAGAACA
CGTCGGATTGTCCGTTTATGACCCCAATATGCCGACCGCCTTAGACCCGTATTGCGTCACCAAGGCTACC
GCATTCGGGCGCCAGGCGGCCATGAATGCCGGTACCGCATCATTATTCGGCATGAACATGCTGCCTCTTA
TGGCAATTCTCCAATTCCTGTTCTTTGCCATGACCCCTATAGTGATTGGTGTCGTCATGATGCAGGGGAT
GGCGGGATTGAGTAATTTCGGGAAGTTCCTGCTTTTCGGCGCCTGGACCGAGAGCTGGATGCCTGTCGCC
GCGTTGATCAATGACTACTCGCAGGAGATCATCGGAGAATCGTTCAAGAAAATGGAGGCCCACATGCACG
GCGTCCCCATGACCAGCCCGTCGAACATCGGAATGATTCTGGATCATGCGCAGCGCAATCTTTCCATGGC
GAACCTCATGATGGGCCTGACGCCCGTACTGACATTCGCCATCCTGTCAGGGTCCTATTACGGCTTTTCC
CAGCTTGGGACTGCCATCCGCGGTGACAGCGTGATGGACAAGAACATGAGCGAGTCCACGCCGACGGCGG
GCGCCAGCACCCTGGCGGGCAACACATCTGAGAGGACGCTTGCCAGTACAGGCAATGGTCGCACGTTTGA
AACGGGGACGGCGTTAAATGGGCTCAGTTACGACCTATCCCAAAAAGTCAGTAGCGGACTCTCCGCTGCA
AATACGTCAGCGGTGCAGATGTCAAACGCGGCGACCGCAAGTGCCAGTAGGGTTGGGGAGCAAACCGCAT
CGTATCTTCGCAACGCACAGACCGCCGTAGCCAGCGGCACCGCGCTTTCAAGCGGTGCCAACGATACCGT
TAGCACCATGAGTTCCGCACAGAAAACGCTCTCCACCATGACGGGCCTGTCCGAAGCGCAGGCGACGACA
TTTGCTGCTCGCTTGACAGGTGAACTGGGCGGGAACCTGAATGCCAACGGAATCTCGGAAGGCATGGTTG
CCAAGGCGCTCTCTGGATTCGACATCGGCGGCAAAGCGGCTGCGGAAGAGGCGGCACGCATTACGGGAGA
GATGAAAACATCCGCAGGCCTACAAGCTGCCAGCACCCTCACCAACTCCAACAATCTGTCGAAATTAAGC
GGAATCAACTCCAGCCTGACTCATTCATCCAGCGTGGGCACGAGCGCAAATCTCGGTATGTCCGCCAAGA
AAGCCTGGCAGGAAGGGGCTTCTGCAAATGCAGCAATGTCGCAGGCAGAGCAACTGCAACATCTTTCCTC
TATAGTGCAAGGTCAGGGCGGTTCACAGACGTTTAATGCGGAAAATCTCGGCGCGGCATTAGAACAAAAT
GCGAAACGCATAGGCCTGTCGAGCCATTCATACGCCAACGATATTGCAGACAGAAATGGCCTTCAGGCAA
ATTTCCAAAAAGGAGTTGCCGATGCCGAGAGGCAGGGAATCCGTGGGACAGAGGCCGCTGCCTTCGGCCT
CGTATATGCCGCCAACAGAGCACCGAATGCCGCTGCCGGAGCAAGCGCGATTACCGAAGCTGCCGGCATC
TCTCCTTTCCGTGCTCAGTCTCAGGGTCTTGGTAATGCAGTCCGAGGACAAATCAGCAACAACGCGGCTC
AGACCGATGCAGGTGGGAACGCTGCGGCTATTTCAGGAGCCAAGGCGCAGATAGCTGCAACTAATGCGGC
CACAGGCGGGGCTCCAACACCAGGGAAAGTGCAGGCAGAATATGATGCGGGCCAGGGTGAAGCCGCAGCC
GCTATAGGAGGTAACAACGGGGCTGGTGATTACAATGCCACTGCTGGAAATCAGTTTGCCGCGCAGTACA
AGGCATCCCATCCCAAGGACTTCCAGAGCCCAACCAGTGTCGGATCAGGCAATAGCCAGGTCACTGTCGG
AGCGAATGGCCAACTGGGGGGTAGCACAGTGGGCACGGTGGGTAAGCAGAATGATAATGTGTTGATGAAT
GGGGTTCCCACACCCATCGGCACCATACCTATTGGTGCAAAACAAATGGCTGCACATCCTGACGATACTG
CTGCTGCAATCTCTGGCACTATTGCCGGGGCGGGCGCGCTCAAAGGTGCTGCGGCGATCTATGGGGCGAA
AAAAGCTGCTGATATTGCGGAGCAAAAAGCACTACAAAAATCAATAGATAGTGGAGAGACTGGCTCGGGA
GATGGTTTTGATGTAAATGGCAAACCATTACCAAAGGAAGCTACCCCTCCCCGAACCCCTGACGGTAGCA
GCGATACCATGAGCAGATTAACCGGGCGGCCATCAATCAAAAGCTCGGAGCAGCAGCTTGATGACACCCT
GAAACCACTCAGAGAGATAGATCCCAACCTTGGGGCCGGAGGTGACGCATTTGATGATGTCCCATTCGAG
TAA
 Primer design