SecReT4
Protein ID: 344201046
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_2972
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2919305..2920924 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDG0JTT1
KEGG IDafi:Acife_2972
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 9.1e-54, Aligned region: 40..467
Protein Sequence: 539 a.a.     [Download]
>gi|344201046|ref|YP_004785372.1| TraH family protein [Acidithiobacillus ferrivorans SS3]
MLNQDAPSFRAIAKGVLLAVGSSMVTTMALHEQMAYGLGMQSFVQGMFSATSAPTLANTGNGYTLSGGYS
EIRTPLSGVNILSFSPPDISAGCGGINLYMGSFHFINGQQFLALLRTIGQQALGYAFQLAIDAMCHQCGA
LLASIQKAITAMNNALHNTCQLAQGIFPATQVENGFKQVGVEALHTMSAAAGDVTDFFTASNSASAAGIA
SHIANTFYKNITQSFNGQTTTRKVPQSALIPEGNMFWKAINNSEAYNLLTNIDAGATGTLTGQACATAGN
NACTKEILMSLVGTEVLRPSASAQGNATQSAMQSQSTSNTPNASYSKNTETVGPSLFLANLVNGTKGAPV
STCQPWVSANNHTYQPFSPNMGCELVDPGQTTLGAMGYEGIARHIKHMMYGGGPGNHLGLVNYLSTGQAL
STNQMAFISTVPAGIVSLMHEAQPNVNLIHTIGQDVAPILVDAYAVKLGTALMSTESSVYNGNSHVVIPK
EYYTAMSGMAQEIDAYSEREAIHENVMNTLTTMVRNYRASLAENGANSQ
 
Nucleotide Sequence: 1620 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2920924-2919305 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGCTAAATCAGGACGCCCCCTCATTCCGCGCCATCGCCAAAGGGGTTTTGCTGGCGGTGGGATCTTCCA
TGGTCACGACCATGGCCCTGCACGAACAGATGGCCTATGGCTTGGGTATGCAGAGCTTCGTGCAAGGCAT
GTTCTCGGCGACTTCCGCTCCGACCCTGGCGAATACCGGCAACGGCTACACCCTTTCCGGCGGCTACTCC
GAGATCCGCACCCCTCTCAGCGGCGTCAACATCCTGTCTTTCAGCCCGCCCGACATCTCCGCCGGATGCG
GCGGCATCAATTTGTATATGGGTTCTTTTCACTTCATCAATGGACAGCAATTTCTGGCGTTACTTCGCAC
CATTGGCCAGCAGGCGCTTGGATATGCTTTCCAGCTCGCCATTGACGCCATGTGTCACCAGTGCGGTGCG
CTACTGGCATCCATCCAGAAAGCCATCACCGCCATGAACAATGCCCTGCACAACACCTGCCAACTGGCGC
AAGGTATATTCCCCGCTACCCAGGTAGAGAATGGCTTCAAACAGGTCGGCGTGGAAGCACTCCATACCAT
GTCGGCTGCTGCCGGCGATGTAACTGACTTCTTCACCGCGAGTAATTCAGCCAGCGCCGCCGGCATCGCT
TCACACATTGCCAACACCTTTTACAAGAACATTACCCAGTCTTTCAATGGGCAGACGACCACCCGGAAAG
TTCCCCAATCGGCCCTAATACCCGAAGGTAATATGTTCTGGAAGGCCATCAACAACAGCGAAGCATACAA
TTTGCTCACCAATATCGACGCAGGAGCAACGGGCACGCTTACTGGTCAGGCTTGCGCCACAGCGGGGAAC
AACGCCTGCACCAAGGAAATCCTGATGTCTCTGGTTGGAACAGAGGTCTTGCGTCCATCCGCGAGCGCCC
AGGGCAATGCAACGCAGTCGGCCATGCAAAGCCAGAGCACATCTAACACCCCCAATGCGTCCTACTCTAA
AAACACTGAAACCGTTGGTCCGAGCCTGTTTCTCGCCAACCTCGTGAATGGCACCAAGGGTGCCCCGGTA
TCGACCTGTCAGCCCTGGGTATCAGCCAATAATCACACTTATCAGCCTTTCTCACCCAACATGGGATGCG
AACTGGTGGACCCTGGCCAAACGACGCTGGGTGCCATGGGTTATGAGGGTATTGCCAGACACATCAAGCA
CATGATGTATGGGGGTGGCCCAGGCAATCATCTCGGGCTGGTGAATTACCTCAGCACCGGACAGGCGCTT
TCCACGAACCAGATGGCCTTCATATCGACCGTCCCCGCCGGGATCGTATCCCTCATGCACGAGGCGCAAC
CCAATGTAAACCTCATACACACCATAGGGCAGGACGTGGCCCCCATTCTGGTGGATGCCTACGCCGTCAA
GCTGGGTACCGCACTGATGTCCACGGAATCCAGCGTTTACAACGGAAATTCCCATGTGGTTATTCCTAAA
GAATATTACACCGCCATGAGTGGTATGGCGCAGGAAATTGATGCGTATTCCGAGCGTGAGGCGATTCACG
AAAACGTGATGAATACCCTGACCACCATGGTTCGCAACTATCGCGCATCCTTGGCGGAAAATGGAGCAAA
TAGCCAGTAA
 Primer design