SecReT4
Protein ID: 344201047
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_2973
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2920935..2921900 [-]
Productpilus assembly protein TraF
Component typeTraF_F
UniProt IDG0JTT2
KEGG IDafi:Acife_2973
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.8e-53, Aligned region: 35..261
Protein Sequence: 321 a.a.     [Download]
>gi|344201047|ref|YP_004785373.1| pilus assembly protein TraF [Acidithiobacillus ferrivorans SS3]
MNGLARALAAIGVAAAMLTAMPGAFAGPLDSNAHGWFWYQLPPPPPPKPKPRPLPIMAPKPVVRPKPKPK
KPQVLSVKWIRVHLKKYRNEAINNPSTKNVTNYLSLQKVMFDKAQNFAEKFVQVANTNPVLNYSNLVPRS
NAGNSAFNTYIADNRQKALQYLTKKVGMWVFVKHDCPFCNMQLGQYRHLLQLAHFRTVYIDVNHGAISGV
PKSAVFVQDHGQAKMLHLVETPAIVMVWPPDNFAVVTQGYQVAGTLMQNIVADAGYVHLLPKKLAQWSTS
AYERGVMTTQEIQAAEKEGITAPGQISNYVQNQTENRIHTW
 
Nucleotide Sequence: 966 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2921900-2920935 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
TTGAACGGGCTGGCACGCGCTCTGGCAGCCATCGGCGTGGCCGCCGCGATGCTCACGGCCATGCCGGGCG
CATTCGCAGGCCCGCTCGATAGTAACGCGCACGGCTGGTTCTGGTATCAGCTCCCGCCGCCTCCGCCACC
GAAGCCCAAGCCGCGGCCATTGCCCATCATGGCTCCAAAGCCAGTGGTAAGGCCCAAACCCAAACCCAAA
AAACCACAGGTTCTTTCGGTAAAATGGATCCGCGTGCATCTCAAGAAGTACCGGAATGAGGCGATCAATA
ATCCCAGCACGAAAAACGTCACCAATTACCTATCGCTTCAAAAGGTGATGTTCGACAAGGCCCAGAATTT
CGCCGAGAAGTTCGTGCAGGTCGCCAATACCAATCCCGTGCTCAATTACTCGAACCTGGTACCCCGGTCC
AATGCCGGCAACAGCGCGTTTAACACCTACATTGCCGACAACCGCCAGAAGGCGCTTCAATACCTTACCA
AGAAGGTCGGTATGTGGGTCTTCGTCAAACACGACTGCCCATTCTGCAACATGCAGCTCGGTCAGTATCG
TCATCTTCTACAGCTCGCCCACTTCCGCACGGTCTACATCGACGTGAATCATGGCGCGATCTCTGGCGTC
CCGAAGAGCGCCGTTTTTGTCCAGGATCATGGGCAAGCCAAAATGCTGCACCTGGTAGAAACACCAGCCA
TCGTGATGGTCTGGCCACCAGATAATTTTGCCGTCGTGACCCAGGGATACCAGGTGGCGGGCACCCTGAT
GCAGAACATTGTGGCCGATGCCGGATATGTGCATCTTCTACCCAAGAAACTTGCCCAGTGGTCCACCAGT
GCCTACGAGCGCGGAGTCATGACCACGCAAGAGATTCAGGCTGCTGAAAAAGAGGGCATCACCGCTCCCG
GGCAGATCAGCAATTATGTGCAGAACCAGACTGAAAACCGGATTCATACTTGGTAG
 Primer design