SecReT4
Protein ID: 344201048
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_2974
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2921897..2922409 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDG0JTT3
KEGG IDafi:Acife_2974
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 170 a.a.     [Download]
>gi|344201048|ref|YP_004785374.1| lytic transglycosylase [Acidithiobacillus ferrivorans SS3]
MGFNALFVITPAWTHQADFHGAPISCIAAASRQYGVPKRDIIALMQNEGAAPGIAAHDSNGTTDLGPMQV
NTCHLPLLRRFGYTYQTLKYNACANVMAGTWVFAQCLAQTGNLLNAAACYNAGVGAMPIAWQNGYVARFA
AHLGLQIPDSPIPQEEAIPAGLVVLKGRGN
 
Nucleotide Sequence: 513 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2922409-2921897 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
TTGGGGTTTAATGCCTTGTTTGTCATCACGCCTGCCTGGACACACCAAGCCGATTTTCACGGCGCACCGA
TCTCCTGCATTGCTGCGGCGTCCAGGCAATATGGTGTCCCGAAGCGGGACATCATCGCTTTGATGCAGAA
CGAGGGCGCAGCCCCCGGCATCGCGGCACACGACAGCAACGGCACCACGGATCTCGGCCCAATGCAGGTC
AACACCTGCCACCTGCCTCTCCTGCGCCGTTTCGGTTACACCTATCAAACACTGAAGTACAACGCCTGTG
CTAATGTCATGGCGGGCACCTGGGTGTTTGCCCAATGCCTGGCCCAGACGGGCAATCTCCTCAATGCCGC
GGCGTGTTATAACGCGGGCGTCGGTGCCATGCCGATAGCCTGGCAGAACGGTTATGTGGCGCGATTCGCG
GCGCACCTGGGGCTACAGATCCCGGACAGCCCCATCCCCCAGGAGGAAGCCATACCGGCGGGTCTCGTGG
TCCTTAAAGGACGGGGGAATTGA
 Primer design