SecReT4
Protein ID: 344201061
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_2987
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2932409..2934238 [-]
Productlipoprotein
Component typeTraD_F
UniProt IDG0JTU6
KEGG IDafi:Acife_2987
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.5e-11, Aligned region: 387..531
TraG-D_C [PF12696], Evalue: 1.2e-06, Aligned region: 388..519
AAA_10 [PF12846], Evalue: 1.4e-06, Aligned region: 120..454
Protein Sequence: 609 a.a.     [Download]
>gi|344201061|ref|YP_004785387.1| lipoprotein [Acidithiobacillus ferrivorans SS3]
MRDKLKLGGSEDTAALLGIAASLWACGPYIVSGPIWQTATGIATAVGGLHLTRKIHRWMDGGEHAIRTRV
DLPSDPPILKVSHHESLPDAVLLGYLTNSGEPLWLPTLGDTKRPEDPPNDHMMILGMSGVGKTVAASEMM
LQQIRAGGGVIFADGKIDSGNINVLWQMLRWTGREDDLVVIHPGDPSVSNTYNPILYGDADEVASRIMSM
VPAAGNSAGADFYRKSATQALSALIAALQRGGYAYTPADLSLLLLSPSELDKLPNLPGIRGTPEGRVAAL
FINRFRVPNKSGGTMINVEKVKDLFGGIGGRLGLMGSGKFGEIANTTRPDVSLYECIMQNKIVYLPLPTM
GKEETASDFAKMFIGDYRTAVSWIQNLPERMRPNPSTLVFLDEPGSYLSDTWDRLFEQARSARQRLMLSP
QTKANLDGVSETLFDKVAGNCATKTFFQLGAQETAEFAGDYIGMRLGVLKTLSESSSDSASESSTDVVGS
GAAGAGAGTTEGEREQEMYKVSPDDLKALGKGECILSWCGSSYFHVKVPMVSFSDEFKQWAGKPKIYAPE
NPRRPRPYRTDYGIFERLDMVIKADQDYIKAQFPAKQEKKADTRKQPDA
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2934238-2932409 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
GTGCGCGACAAGCTGAAGCTGGGAGGCAGTGAGGATACGGCGGCCCTGTTGGGGATCGCGGCCTCCCTGT
GGGCCTGTGGCCCCTATATCGTGTCCGGACCCATCTGGCAGACCGCGACCGGCATTGCTACGGCGGTCGG
CGGTCTGCACCTCACCCGCAAGATTCATCGCTGGATGGACGGTGGAGAGCACGCGATCAGAACCCGCGTC
GATCTCCCCTCTGACCCCCCTATTCTCAAGGTTTCGCATCACGAATCCTTGCCGGATGCCGTATTGCTCG
GCTATTTGACCAATTCCGGTGAACCGCTGTGGCTGCCGACTCTGGGCGACACCAAACGCCCGGAGGATCC
ACCGAACGATCACATGATGATTCTCGGCATGTCCGGTGTCGGCAAGACGGTCGCTGCCAGCGAAATGATG
CTGCAACAAATCCGCGCCGGCGGTGGTGTCATCTTCGCCGATGGCAAGATAGACTCCGGCAATATCAACG
TGCTCTGGCAGATGCTCCGCTGGACCGGGCGCGAAGATGACCTGGTGGTGATCCATCCAGGTGATCCTTC
CGTCAGCAATACCTACAACCCCATCCTTTATGGTGACGCAGATGAAGTGGCCTCGCGTATCATGTCCATG
GTCCCTGCCGCCGGCAACAGTGCGGGTGCGGACTTCTACCGCAAGAGTGCGACACAGGCCCTCAGCGCCC
TCATAGCCGCACTGCAGCGCGGCGGATACGCCTATACCCCTGCCGACCTCTCCCTCTTGCTTCTGAGCCC
CTCGGAACTCGACAAACTCCCCAACCTGCCGGGTATTCGCGGTACGCCGGAGGGTCGTGTAGCCGCATTG
TTCATCAACCGCTTCCGGGTGCCCAACAAGTCCGGCGGCACAATGATCAATGTCGAGAAGGTCAAGGATC
TGTTCGGCGGCATCGGCGGTCGTCTTGGCCTCATGGGGTCCGGCAAGTTCGGTGAGATTGCCAACACCAC
CCGCCCCGACGTGAGCCTCTACGAGTGCATCATGCAAAACAAGATCGTCTATCTTCCCCTACCCACCATG
GGCAAGGAAGAGACGGCCTCCGACTTCGCTAAAATGTTCATTGGAGACTATCGCACAGCCGTCTCCTGGA
TTCAAAATCTTCCAGAGCGGATGCGCCCCAATCCATCCACCCTGGTCTTTCTGGATGAACCGGGATCCTA
CCTGTCGGACACCTGGGACCGCCTCTTCGAGCAGGCCCGCTCCGCCCGCCAGCGACTCATGCTCAGCCCG
CAGACCAAAGCCAACCTCGATGGCGTATCAGAAACCCTGTTCGATAAGGTGGCGGGCAACTGTGCCACGA
AGACCTTCTTCCAGCTCGGTGCTCAGGAGACGGCGGAGTTTGCCGGGGATTACATCGGGATGCGGTTGGG
CGTGTTGAAAACGCTCTCGGAAAGCAGTTCGGATTCTGCCAGCGAATCCTCAACGGATGTGGTAGGCAGT
GGCGCCGCCGGGGCGGGAGCGGGAACCACGGAAGGCGAACGTGAGCAGGAGATGTACAAGGTTTCCCCGG
ATGACCTCAAAGCGCTCGGCAAGGGCGAGTGCATTCTCTCTTGGTGTGGAAGCAGCTACTTTCACGTCAA
GGTGCCCATGGTTTCCTTCAGCGACGAGTTCAAGCAGTGGGCGGGAAAACCCAAAATCTATGCTCCCGAG
AACCCCAGGCGTCCGCGTCCGTATCGGACGGATTACGGCATTTTCGAGCGCCTTGATATGGTCATCAAGG
CCGATCAGGACTACATCAAAGCGCAGTTCCCGGCGAAGCAGGAGAAGAAGGCCGACACCAGGAAACAGCC
CGATGCTTAG
 Primer design