SecReT4
Protein ID: 344201109
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3036
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2967379..2970438 [-]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDG0JUE0
KEGG IDafi:Acife_3036
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.1e-24, Aligned region: 592..689
TraN [PF06986], Evalue: 1.1e-24, Aligned region: 859..938
Protein Sequence: 1019 a.a.     [Download]
>gi|344201109|ref|YP_004785435.1| conjugal transfer protein TraN [Acidithiobacillus ferrivorans SS3]
MGFFVWMGHPKRQRRAGVLFMSWMVGMGIYYESTATAEASTFINQAQSGANFGNSLLMGGQSDAANNAGT
TEMQGFAGMSPTGGQTQASSYYLSNNVGMTPGNALNQADSANSALMSDPSCPAGWPGPLNTFQQNGVGSV
TALEHTCQAPLLAARSSIETAGGGAAATGAYAGALAAINTFQQAEKRADSAGNNLETSCAPVINGAYQYA
PACNLLSQSGTASVAALGSTWDSTIAPLESRCSTLYTSITTPTAAQGLANVLTSMTASLDGLIGTSLTGG
AVNVSNNGDGAVALPAGYGTGQTQASQQYQQILGACTYAQSYLENISSYPGGMNAYASDPIINNFMSNPA
NQPMINNMMPFIESNPSVFGQYYQNVACTNNNTSIANASTTATGPSTTTTSAPSLNSNPVACTAPLSTYE
STGWITNFPDPNAQWIYGVTGGCGAGVPNGQTDLMEGTYSNTTGAPINATLYLAADDEGIVNINGTQVAS
YSDGGTGGTGAQAYPATGGVVSVPITLSPGPDEIMYYITNSAGSSSGNNPSAGILSIIGTVNGQNQVLID
TNSSWVYVPQNAAQAGSTVTVNPGSVTANTTPNTHAQSILCNSPIQCMGTQCHALFGNQDLHFSQALTAL
SAIQQMEQGAMCATGTSIAAGNCQPILFGGVMRYCRTWPAGGVFTNNCCAQGLKDAGASGNLANYLLLAH
DTWKIANAPFVDAHVWGFGAFHGWVESAYSTMDQWAATSWRYVTTVFKGAAEAVSNAFGIVGSTSFQGAG
IMSNAAFSAGTPATQGLITSMESMIKSWLIQAAEWVLKKIFGAAMEQAIVTAITNFVASQFASDIMAFFS
VIGWIYLVYQILQIIGNLLTACKNEEFKLGQKRKLHACQNLGTYCASKALGICIEHKDVFCCYASPLSRI
IASQIKIGQPNVAGGYGSAQNPQCGGFTVQQLAAVDWAEVSLSAWQAMLQNAGLISGSNAQGAATYTPAQ
ITHPAGDVNISQAPISVGHGPIAPQTPGASQTGNPNAIP
 
Nucleotide Sequence: 3060 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2970438-2967379 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGGGATTCTTCGTTTGGATGGGCCACCCCAAGCGTCAGCGCCGCGCCGGTGTGCTGTTTATGTCGTGGA
TGGTCGGCATGGGGATTTACTACGAATCCACGGCGACCGCTGAGGCGAGCACTTTTATTAACCAGGCGCA
AAGCGGTGCCAACTTCGGCAACTCCTTGCTCATGGGCGGGCAAAGCGATGCCGCTAATAACGCCGGTACC
ACGGAGATGCAGGGCTTCGCCGGAATGAGTCCGACAGGAGGCCAAACGCAAGCATCCTCCTACTATCTCT
CGAACAACGTGGGTATGACCCCCGGCAATGCCCTCAACCAGGCCGATAGCGCCAATTCCGCGCTGATGAG
TGATCCATCGTGCCCCGCTGGATGGCCCGGCCCGCTCAACACTTTTCAGCAGAACGGCGTGGGTAGCGTC
ACAGCCCTTGAGCACACCTGCCAGGCGCCCCTGCTGGCCGCCCGGAGCAGCATAGAGACGGCGGGTGGGG
GTGCCGCCGCCACGGGTGCTTATGCGGGCGCTCTGGCCGCCATCAACACCTTTCAGCAGGCGGAGAAGCG
CGCAGATTCCGCAGGCAATAACCTCGAAACCTCCTGTGCGCCCGTCATCAACGGCGCTTACCAGTACGCA
CCCGCCTGCAATCTTTTGAGTCAGTCGGGCACAGCGAGCGTTGCCGCGCTTGGATCCACCTGGGACAGCA
CCATAGCGCCCCTGGAGTCGCGCTGCAGCACGCTCTATACCAGCATCACGACTCCCACTGCCGCCCAGGG
TCTTGCCAATGTATTGACCTCGATGACCGCCAGCCTCGACGGGCTTATCGGTACAAGCCTCACCGGCGGT
GCGGTGAATGTCAGCAATAACGGTGACGGCGCGGTGGCCCTGCCTGCAGGCTACGGCACTGGCCAGACGC
AGGCATCGCAGCAGTATCAGCAGATTCTTGGTGCCTGCACCTACGCCCAATCCTATCTGGAAAACATTTC
GTCGTACCCGGGCGGCATGAATGCCTACGCCAGTGACCCCATTATCAACAACTTCATGAGTAATCCGGCG
AATCAGCCGATGATCAACAATATGATGCCGTTCATCGAGAGCAACCCATCGGTGTTCGGCCAGTATTATC
AGAACGTCGCCTGCACGAATAACAACACCAGTATCGCCAATGCCAGCACGACGGCGACAGGACCAAGCAC
GACCACTACCAGTGCGCCCAGCTTGAACTCTAACCCCGTTGCCTGCACCGCACCTTTATCCACTTACGAA
AGCACAGGATGGATCACCAACTTCCCTGATCCTAACGCGCAATGGATATACGGTGTAACGGGGGGCTGTG
GGGCCGGCGTGCCCAACGGTCAAACCGATCTCATGGAGGGCACATACTCCAATACGACAGGTGCCCCGAT
CAACGCCACACTTTATCTGGCGGCGGACGATGAGGGCATCGTCAACATCAATGGGACGCAGGTGGCGTCC
TATTCGGACGGCGGAACGGGCGGCACCGGGGCGCAAGCCTATCCCGCTACTGGGGGTGTGGTTTCAGTCC
CGATAACCCTCAGCCCGGGGCCGGACGAAATCATGTATTACATCACCAATAGTGCGGGATCTTCGTCTGG
AAACAACCCATCGGCGGGCATACTCTCCATCATCGGCACCGTGAACGGTCAAAATCAGGTGCTCATCGAC
ACGAATAGTTCCTGGGTGTATGTGCCGCAAAACGCGGCGCAGGCGGGATCCACCGTCACCGTCAACCCCG
GATCTGTGACAGCCAACACCACGCCGAACACCCATGCGCAGAGCATTCTTTGCAACAGTCCGATTCAGTG
CATGGGTACCCAGTGTCATGCCCTGTTCGGCAACCAGGACCTGCACTTCAGTCAGGCGCTCACGGCACTG
TCAGCCATACAACAGATGGAACAGGGTGCGATGTGCGCGACAGGCACGTCTATTGCCGCGGGTAATTGTC
AGCCCATCCTCTTCGGCGGAGTCATGCGGTATTGTCGTACCTGGCCCGCCGGCGGCGTGTTTACCAATAA
TTGTTGTGCGCAAGGATTAAAAGACGCCGGTGCAAGCGGAAATTTGGCCAATTACCTCCTGCTAGCACAC
GACACCTGGAAAATCGCCAACGCACCATTCGTGGATGCTCACGTCTGGGGCTTTGGCGCGTTTCATGGTT
GGGTCGAAAGCGCCTACAGCACCATGGATCAATGGGCGGCTACTTCCTGGCGCTATGTCACCACGGTTTT
CAAGGGAGCGGCTGAAGCCGTTAGCAATGCGTTTGGCATCGTTGGATCAACCTCTTTTCAGGGGGCTGGA
ATCATGTCGAATGCAGCTTTTTCGGCGGGGACGCCAGCCACGCAGGGCCTAATTACCTCGATGGAATCCA
TGATTAAGTCCTGGCTCATACAGGCTGCAGAGTGGGTGCTAAAAAAGATTTTTGGCGCGGCCATGGAGCA
GGCCATTGTCACAGCAATAACCAATTTTGTAGCTTCACAATTTGCTTCTGACATTATGGCATTTTTCAGC
GTGATTGGCTGGATATATCTGGTCTATCAGATTTTACAGATCATAGGAAATCTTCTTACCGCGTGTAAGA
ACGAAGAGTTCAAGTTGGGGCAAAAGCGCAAACTTCATGCCTGTCAGAATCTAGGAACATACTGCGCCAG
TAAGGCCCTGGGCATCTGCATAGAGCACAAGGATGTGTTCTGTTGTTACGCGAGCCCACTTTCGAGAATT
ATCGCGTCGCAGATCAAGATCGGACAACCGAATGTCGCGGGCGGATATGGCTCCGCGCAAAACCCCCAGT
GCGGCGGCTTTACGGTGCAACAACTGGCGGCGGTGGATTGGGCTGAAGTGTCGCTCAGTGCATGGCAGGC
GATGCTCCAGAATGCAGGGCTTATTTCCGGGAGCAACGCACAAGGTGCTGCGACCTATACACCTGCGCAA
ATAACGCATCCGGCGGGCGACGTGAATATCAGCCAGGCACCCATATCCGTAGGTCATGGGCCGATTGCGC
CGCAAACGCCGGGCGCGTCGCAGACAGGAAATCCCAATGCAATTCCTTAA
 Primer design