SecReT4
Protein ID: 344201110
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3037
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2970442..2971701 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDG0JUE1
KEGG IDafi:Acife_3037
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.7e-40, Aligned region: 48..324
TraU [PF06834], Evalue: 3.7e-40, Aligned region: 367..408
Protein Sequence: 419 a.a.     [Download]
>gi|344201110|ref|YP_004785436.1| TraU family protein [Acidithiobacillus ferrivorans SS3]
MWSAMRLRTWIAAGLTALSMSVPLPALASGAQVATMCPDAGVFKELIGGVCWSALFPLRIAGSTWFGGNS
GVPNGAASGAVCECGGSWKHLTLPTVGIQIGYWQPTMLIEAVSHPFCSPVLGGVSLSPSSTTGNQWTGSW
GGNIGTGTSTGQHNSTFFNVQLWTFPLITMMQLANIPDCNTGYSGMNLMLMSEVFPTWNNDLLSFLASPE
ELLYDNPIGLIGSAEECAQESVGAQPIDNEYWTAGCWGLLYPMVGSNLDGNDPIQASSMDVSRMIAMGFR
LGFLERTMGNSTLCGPRRTYVLPKAQFRFQILFPNDETNQEPNASINLGNTTQPSAQSIPPANYVTPAAS
SQGTVAQPGGVNIQAPPTQSGECTHWMGQSPFQWGEWDSQPATGGNYVYLVWQWTNCCLGIIGHQGPTG
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2971701-2970442 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGTGGTCAGCTATGCGTCTTCGCACATGGATCGCGGCAGGTCTCACAGCCTTGAGCATGAGCGTACCCC
TGCCCGCTCTGGCCAGTGGCGCACAGGTAGCGACCATGTGCCCGGACGCGGGCGTTTTCAAGGAGCTGAT
CGGCGGAGTGTGCTGGTCAGCCCTCTTTCCGTTACGCATTGCGGGATCGACGTGGTTCGGCGGCAATTCC
GGGGTACCCAATGGCGCCGCGTCCGGGGCCGTTTGTGAGTGTGGCGGGAGCTGGAAGCATCTCACCCTAC
CAACTGTCGGTATCCAGATCGGATACTGGCAGCCCACCATGCTCATTGAGGCCGTGAGCCATCCCTTTTG
TTCGCCGGTTCTGGGCGGCGTGAGCTTGTCGCCCAGTTCGACCACGGGCAACCAGTGGACCGGATCGTGG
GGTGGCAACATCGGCACCGGCACATCCACAGGGCAACACAACAGCACCTTTTTCAATGTGCAGCTTTGGA
CCTTCCCGCTCATCACGATGATGCAGCTTGCCAACATACCTGACTGCAATACGGGTTACAGTGGCATGAA
TCTCATGCTCATGAGCGAAGTGTTCCCAACCTGGAATAACGATCTCCTGTCCTTTTTAGCTTCGCCGGAA
GAGTTGCTGTACGACAATCCCATCGGATTGATCGGTTCCGCTGAAGAGTGTGCCCAGGAAAGTGTTGGTG
CCCAGCCTATCGACAATGAATACTGGACGGCGGGCTGCTGGGGGCTGCTCTATCCGATGGTCGGCAGCAA
TCTCGACGGCAATGACCCCATACAGGCGTCCAGTATGGACGTGTCACGGATGATCGCCATGGGATTCCGT
CTCGGATTCCTGGAACGCACCATGGGCAACAGCACGCTCTGTGGCCCTCGCCGCACCTATGTCCTGCCCA
AGGCGCAGTTTCGTTTTCAGATTCTTTTTCCGAACGATGAAACCAATCAGGAACCCAACGCCAGCATCAA
TCTCGGCAATACCACGCAGCCGTCCGCACAGAGCATCCCCCCGGCCAACTATGTGACCCCGGCGGCGAGC
AGTCAGGGCACGGTGGCGCAACCGGGCGGCGTGAATATCCAGGCCCCGCCGACGCAATCGGGGGAGTGTA
CGCACTGGATGGGACAATCACCCTTTCAATGGGGGGAATGGGATAGCCAGCCCGCGACCGGGGGCAACTA
CGTCTATCTGGTCTGGCAGTGGACCAACTGCTGTCTCGGCATCATCGGCCACCAGGGACCTACGGGATAA
 Primer design