SecReT4
Protein ID: 344201111
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3038
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2971703..2972968 [-]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTraW_F
UniProt IDG0JUE2
KEGG IDafi:Acife_3038
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 6.7e-17, Aligned region: 116..202
Protein Sequence: 421 a.a.     [Download]
>gi|344201111|ref|YP_004785437.1| type-F conjugative transfer system pilin assembly protein TrbC [Acidithiobacillus ferrivorans SS3]
MIAPAIDQQQVAAIVQRSDAIMSTASTRSVPAWLREPKATPAERAAVKPQLDKQVANILQEYATQYAPQS
NGKAQAWLRTRVNGVPVVPPNLHGKALQEYVDHTLMVKEENAAKTLVFISMDMPHNLLRRWFKEVADNKH
LFETTVFVLRGWPNKAEGLPEMISTVNKLMPSFKKTANVEINPILFTDHQVNLVPVIIHQEPNQQWGVMV
GDEYGFRGAVKRIDKGKGSPTKVRGEAWKVAEPNMVAVFQQKIKHFNWKAEEAKGKAHDWQSVRARLGDP
LPDSLRGRNYTFNPSVIATRTIRLPNGKLLVHKGQEIDPLTMFPFPWSQSYIVLNPSQPWQVRQVQAWES
MYPNVVIMASELPATWQGENAVVNALNHPVYGIYPELAQRLGINRVPALIRPDGGVLSITVPKEPLPGER
K
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2972968-2971703 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGATCGCGCCGGCCATTGATCAACAGCAGGTCGCGGCCATCGTGCAAAGGTCTGATGCCATCATGAGCA
CCGCCAGTACCCGGTCGGTTCCTGCATGGCTTCGAGAGCCCAAGGCGACACCCGCAGAGCGGGCCGCGGT
CAAGCCACAACTCGATAAGCAGGTCGCCAATATCCTGCAGGAATACGCCACCCAGTACGCGCCACAGAGC
AACGGCAAGGCGCAGGCATGGCTTCGCACACGGGTGAACGGCGTACCGGTGGTGCCGCCCAATCTGCACG
GCAAGGCGCTCCAGGAATATGTCGATCACACCCTCATGGTGAAAGAGGAAAATGCGGCGAAAACGCTGGT
GTTCATCAGCATGGATATGCCGCATAACCTCTTGCGGCGCTGGTTCAAAGAGGTCGCCGATAACAAGCAT
CTCTTCGAGACCACGGTGTTTGTCCTCAGAGGATGGCCGAATAAGGCGGAAGGGCTGCCGGAAATGATCA
GCACTGTGAACAAGCTCATGCCCTCTTTCAAAAAGACCGCAAACGTGGAGATCAACCCCATCCTGTTCAC
TGATCACCAGGTCAACCTGGTGCCGGTGATCATCCATCAAGAGCCCAATCAGCAATGGGGCGTGATGGTC
GGTGACGAGTATGGGTTTCGCGGGGCGGTAAAGCGCATCGACAAAGGCAAGGGGAGTCCTACCAAGGTGC
GCGGCGAGGCATGGAAGGTCGCCGAACCCAACATGGTTGCCGTGTTCCAGCAGAAGATCAAACACTTCAA
CTGGAAGGCGGAGGAGGCCAAGGGCAAAGCCCACGACTGGCAAAGCGTGCGGGCACGGCTGGGTGACCCT
TTGCCGGATTCTCTGCGCGGGCGGAACTACACCTTTAATCCTTCCGTCATCGCCACCCGGACGATCCGCC
TGCCCAACGGCAAACTGCTGGTCCACAAAGGACAGGAGATCGACCCGCTCACCATGTTCCCCTTCCCCTG
GAGCCAATCCTACATCGTCCTGAATCCGTCCCAACCGTGGCAGGTAAGGCAGGTACAGGCATGGGAAAGC
ATGTACCCCAATGTCGTGATCATGGCGAGCGAGTTGCCTGCCACCTGGCAGGGAGAGAATGCCGTGGTAA
ACGCCCTGAATCACCCGGTCTACGGGATTTATCCGGAGTTGGCGCAACGGCTGGGCATCAACCGGGTACC
GGCACTGATCCGGCCCGACGGCGGTGTGTTGTCCATTACGGTTCCGAAAGAACCATTACCGGGAGAGAGA
AAATAA
 Primer design