SecReT4
Protein ID: 344201116
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3043
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2975898..2978492 [-]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDG0JUE7
KEGG IDafi:Acife_3043
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.7e-42, Aligned region: 459..739
TraC_F_IV [PF11130], Evalue: 1.2e-25, Aligned region: 15..250
Protein Sequence: 864 a.a.     [Download]
>gi|344201116|ref|YP_004785442.1| type-IV secretion system protein TraC [Acidithiobacillus ferrivorans SS3]
MSTLNDQLYRIIERRRLDTLFPWYAWDPERKLIFMNRGYVGTTMACNLLSGADDSLMDELGAALSINLPA
GTFIQIVNWNVPDVTNIIFDYKSARDGIFSDTGLTGAQKKLLDGFTDNIAGFMTGMEKNGKAFKDSGVPL
TQSMVLISIKVPTAEIPSDEHIKLADEQISAFQSSLNTFNPQRLSRETTLSIWRRFFNIQGEWEYDADDT
TLLRDQILGPGDAISDDGGMFTISHGNDKEDVISVLSIKGFSRPVNVFSTDFLMGDPLGKTTQLIRPAAL
VWTIHIPDQVKKRRQVTAKSLAINWQAFGRMVKWVPRIGLKKEGTDYLVHALNNGEHALEMAFTAILWGR
NAKEAKQAASNFTSHAGKAGFTMLPDKYLALPMFLNALPMFPDTESMGMTHRLKSVATSHATAAAPILVD
WTGNAGQGRMTTKGAGTIFISRRGHVMLFDLYSSQSGQNFVLAGMTRSGKTVTGQQLIMDQLALGAQVWV
IEIGRGFEKLCKLFGGDHIDVRPDMDIGLNPFSSVETLDDELEELVGIIGTMISPSGDLSDSDMATIRLA
IRGVYGANGTNATPTHVAQYLAAQDHKSRAIEMAEMMHEFTENGAYGHWFNKPMNVDLTARFVNLELIEL
QRRPHLMMVVLMQMMFAIARQISADKDPDDVRPLILFVDEASVLLKIPTAAYFLEGLARRIAKHRGALGI
GIQGLSDLYANEQTRTIAAQTAHFIVMKQMGDTIKQLEKNEQFDIGSYGLSLMRTVRKTAEYAEAFIFSE
GAMGIGRLKLDPYRRVLFSTEGPEKEEVLADMRAGMDPDSAIRKFMATHPGYIEAQEQAPEEEDEEDTDP
PDYLQSIADTEAAEAIGNKVKEVA
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2978492-2975898 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
GTGAGCACGTTAAACGATCAGCTTTACCGGATCATCGAACGGCGTCGCCTGGATACGCTTTTCCCCTGGT
ATGCCTGGGATCCTGAAAGGAAGCTCATCTTCATGAATCGCGGGTATGTGGGGACCACTATGGCCTGCAA
CCTGCTGTCCGGCGCGGATGATTCGCTCATGGACGAGCTGGGTGCCGCGTTGTCCATCAATCTGCCAGCC
GGGACATTCATTCAGATCGTCAACTGGAACGTGCCGGATGTCACCAACATCATCTTCGATTACAAAAGTG
CCCGTGATGGCATCTTTTCCGATACGGGCCTCACCGGGGCGCAGAAGAAGCTGCTGGACGGGTTCACCGA
CAATATTGCCGGGTTTATGACCGGGATGGAGAAGAACGGCAAAGCCTTCAAGGATTCGGGGGTGCCGCTC
ACCCAGAGCATGGTGCTGATCTCGATCAAGGTGCCCACAGCGGAGATTCCGAGTGATGAGCATATCAAGC
TGGCTGACGAACAGATCAGCGCCTTTCAGTCCAGCCTCAACACCTTTAATCCGCAGCGACTGAGCCGGGA
GACGACACTCTCCATCTGGCGTCGTTTCTTCAATATCCAGGGCGAATGGGAATATGACGCTGACGACACC
ACTTTGCTGCGTGACCAAATACTTGGTCCTGGTGATGCGATAAGCGACGACGGCGGCATGTTCACGATCT
CGCATGGAAACGATAAGGAAGATGTGATCTCCGTGCTTTCCATCAAAGGGTTTTCGCGCCCGGTGAACGT
CTTTTCGACGGATTTTCTGATGGGTGACCCGCTGGGGAAAACTACCCAGCTTATCCGTCCGGCTGCGTTG
GTCTGGACCATACACATACCCGATCAGGTCAAAAAGCGCAGACAGGTCACGGCCAAAAGTCTGGCGATCA
ACTGGCAGGCTTTCGGGCGCATGGTGAAGTGGGTGCCGCGCATCGGCCTGAAAAAAGAGGGCACAGACTA
TCTGGTTCACGCCCTCAATAATGGCGAGCACGCGCTGGAGATGGCATTTACCGCCATTCTCTGGGGGCGC
AACGCCAAAGAAGCAAAGCAGGCTGCCAGCAACTTCACCAGTCATGCGGGTAAAGCAGGGTTTACCATGC
TGCCCGACAAATATCTGGCATTGCCCATGTTCCTCAATGCCTTACCCATGTTCCCCGATACGGAAAGTAT
GGGCATGACGCACCGGCTCAAATCGGTGGCTACGAGTCATGCCACAGCCGCGGCGCCCATCCTCGTGGAC
TGGACCGGCAATGCCGGCCAGGGCCGCATGACGACGAAAGGCGCCGGTACCATTTTTATAAGCCGACGCG
GGCACGTCATGCTCTTCGACCTTTATTCTTCTCAGTCTGGTCAAAACTTCGTTCTGGCGGGCATGACCCG
TTCCGGCAAAACCGTCACCGGGCAACAGCTCATCATGGACCAGCTTGCCCTGGGTGCCCAAGTCTGGGTC
ATCGAAATCGGCAGAGGATTCGAGAAGCTGTGCAAACTCTTCGGCGGAGACCATATCGACGTGCGGCCCG
ACATGGACATCGGCCTGAATCCCTTTTCCAGTGTGGAAACGCTGGACGACGAACTGGAGGAACTGGTCGG
GATCATCGGCACCATGATTTCGCCGAGTGGCGATCTGAGCGATTCCGATATGGCTACCATCCGCCTCGCC
ATTCGCGGGGTTTACGGGGCCAATGGCACCAACGCCACACCTACCCACGTCGCGCAGTACCTCGCGGCAC
AGGATCACAAATCGCGTGCCATAGAAATGGCGGAGATGATGCACGAATTTACGGAAAACGGGGCTTATGG
GCACTGGTTCAACAAGCCCATGAATGTCGATCTCACGGCGCGATTCGTCAACCTCGAACTGATCGAGCTT
CAAAGGCGCCCGCATCTCATGATGGTCGTACTGATGCAGATGATGTTCGCCATCGCCCGTCAAATCTCCG
CTGATAAAGATCCAGATGACGTGCGCCCACTAATCCTCTTCGTCGATGAGGCCAGCGTGCTCCTGAAAAT
ACCCACGGCAGCCTATTTCCTTGAAGGGTTGGCTCGGCGCATCGCCAAGCATCGTGGCGCACTCGGTATC
GGGATTCAGGGACTTTCGGATCTGTACGCCAATGAACAAACCAGAACCATCGCGGCGCAAACTGCCCACT
TTATCGTCATGAAGCAGATGGGCGACACGATCAAGCAGCTCGAAAAAAACGAGCAGTTCGACATAGGCAG
CTACGGATTATCCCTCATGCGGACGGTGCGCAAAACAGCGGAGTACGCAGAGGCGTTTATTTTCAGCGAA
GGCGCTATGGGCATCGGGCGGTTGAAGCTCGACCCCTACCGGCGTGTGCTCTTTTCAACGGAAGGCCCGG
AGAAAGAGGAAGTCCTGGCGGATATGCGGGCAGGCATGGATCCCGACTCCGCTATCCGCAAGTTTATGGC
AACCCATCCGGGCTACATCGAAGCACAGGAGCAGGCCCCCGAAGAAGAAGACGAAGAGGACACCGATCCG
CCGGATTATCTCCAATCCATTGCGGATACAGAAGCCGCGGAAGCCATTGGTAACAAAGTGAAGGAGGTCG
CGTGA
 Primer design