SecReT4
Protein ID: 344201120
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3047
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2981201..2981605 [-]
Productconjugal transfer protein TraA
Component typeTraA_F
UniProt IDG0JUF1
KEGG IDafi:Acife_3047
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.4e-06, Aligned region: 24..104
Protein Sequence: 134 a.a.     [Download]
>gi|344201120|ref|YP_004785446.1| conjugal transfer protein TraA [Acidithiobacillus ferrivorans SS3]
MDAVMGKAVNRYDQMIARLDQMLGSKKALMTAALLLVAVMMMAIQAHAGTGGTSFSAVATKIEGWAQGDL
GLAIVAGGLIFGVATMVFTGKGTVLAVVVGGAVALYYGIPVLIKIFAATAGTIISHTLILHGVA
 
Nucleotide Sequence: 405 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2981605-2981201 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGGATGCTGTAATGGGTAAGGCGGTCAACCGGTACGATCAGATGATCGCCCGTCTTGACCAGATGTTGG
GCAGCAAGAAGGCACTCATGACGGCGGCCCTGTTGCTCGTCGCCGTGATGATGATGGCGATACAGGCGCA
CGCCGGTACGGGTGGTACGTCCTTCTCCGCCGTCGCCACCAAGATCGAAGGCTGGGCGCAGGGCGACCTG
GGTCTGGCCATCGTCGCGGGTGGTTTGATCTTTGGTGTGGCCACCATGGTCTTCACGGGTAAGGGTACCG
TGCTGGCCGTCGTGGTCGGCGGTGCCGTGGCGCTGTACTACGGTATCCCGGTCCTCATCAAGATCTTCGC
GGCTACTGCGGGCACGATCATCAGTCACACGCTGATCCTGCATGGCGTTGCCTGA
 Primer design