SecReT4
Protein ID: 344201121
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3048
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2981649..2982179 [-]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDG0JUF2
KEGG IDafi:Acife_3048
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.6e-12, Aligned region: 26..160
Protein Sequence: 176 a.a.     [Download]
>gi|344201121|ref|YP_004785447.1| type IV conjugative transfer system protein TraV [Acidithiobacillus ferrivorans SS3]
MMNRYLTVSFTLATVILSGCGASHPCIHGKGGVCVGPREVWGITRHRDQVNPDKSTIKEQALARKLLRTA
PGKNDVLPSLHPATATSGTTVAGGGASQSQATAPDSGNTGTAPMMAPLHYPRPLISQPKVLRVWVAPYHG
PEGNLHFPGMVYSIITPQTWTLGSGSAHTQIPVPVS
 
Nucleotide Sequence: 531 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2982179-2981649 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGATGAATCGCTATCTCACCGTTTCTTTTACATTGGCCACCGTAATCCTCAGCGGATGTGGGGCCAGCC
ATCCGTGTATTCACGGCAAGGGCGGGGTCTGCGTCGGTCCTCGTGAAGTGTGGGGTATCACACGTCACAG
GGACCAGGTGAATCCAGACAAAAGCACCATTAAGGAACAGGCGCTTGCGCGAAAGCTCTTGCGGACAGCG
CCCGGTAAAAACGATGTTCTACCTTCTCTGCACCCGGCGACCGCCACTTCTGGAACCACGGTGGCCGGTG
GCGGCGCAAGCCAATCTCAGGCGACAGCACCGGATTCAGGCAACACCGGGACTGCACCCATGATGGCCCC
TCTGCATTACCCCAGGCCGCTCATTTCGCAGCCCAAGGTATTGCGGGTCTGGGTCGCACCCTACCATGGT
CCGGAAGGAAATTTGCACTTTCCGGGGATGGTGTACTCCATCATCACGCCGCAGACGTGGACTTTGGGAA
GTGGGTCCGCCCATACCCAGATTCCCGTTCCGGTGAGTTGA
 Primer design