SecReT4
Protein ID: 344201122
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3049
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2982176..2983735 [-]
Productconjugal transfer protein
Component typeTraB_F
UniProt IDG0JUF3
KEGG IDafi:Acife_3049
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.2e-31, Aligned region: 239..442
Protein Sequence: 519 a.a.     [Download]
>gi|344201122|ref|YP_004785448.1| conjugal transfer protein [Acidithiobacillus ferrivorans SS3]
MVGIKDRAKLWWKTQSPETKQKLKFGGLAAGVVGAVIIGSQLAGPHNHSAENAALKKAMTTNSQVYVEHP
NSQTPAEMEARIDHLEDQMKKLVKITAAESGMTKDQEKDLSGHISKTLLAKLKAEHQASPNGAPSPQLQQ
LEGSISALQNQIALMRSQPAQQQQYTPLQTWVPASSPVVLGQLPQAPNEIPSSNVPTAQGGIPAAPTTPA
HLDTVNLKHPHKLSTVMNAVTVKSKKGIYLPAGTILTGVLVNGLQAGTGPQAKTNPQIVDIRVKKRAILP
NGLRANLENCMAIASGYGSIGNQRVYMRTNMLSCVARGGKVISAPIHAYIVGSDGLVGVSGKVVSHQGPA
MMKSFIAGIFSGLGNAVQPMGVQGLNLNPASGSTQGFQMPSPSYIGAEAAGGGVSTAAGQISKFYLNEAE
SMLPTIQVNPAVAVSMILETGVRVHTDGESKAQIQEAQLQSAQSLNNSPMALGGMQSRYGETSPYAGSGQ
SPAVASAFPGQGQYNNSPEAQTRQEYARP
 
Nucleotide Sequence: 1560 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2983735-2982176 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGGTAGGTATCAAGGATCGCGCCAAGCTCTGGTGGAAAACCCAAAGCCCGGAGACCAAGCAAAAACTCA
AGTTTGGAGGTCTTGCTGCGGGTGTGGTTGGCGCTGTTATCATCGGCAGCCAGCTCGCAGGACCGCACAA
CCATAGTGCGGAAAATGCCGCATTGAAGAAAGCCATGACCACCAACAGCCAGGTCTATGTCGAGCATCCC
AACTCCCAGACGCCTGCGGAAATGGAAGCGCGGATAGACCATCTGGAAGACCAGATGAAGAAGCTCGTCA
AAATCACGGCGGCTGAAAGCGGGATGACGAAAGATCAGGAAAAAGACCTTTCCGGGCATATCAGCAAAAC
CCTGCTCGCCAAGCTGAAGGCGGAGCATCAGGCCTCGCCCAACGGAGCCCCAAGCCCTCAGTTGCAGCAG
TTGGAAGGCAGTATTTCCGCACTGCAGAATCAAATTGCTTTGATGAGATCTCAACCCGCACAGCAGCAGC
AATACACGCCGCTGCAGACCTGGGTGCCGGCATCAAGTCCGGTGGTTTTGGGACAGTTGCCGCAAGCGCC
AAATGAAATACCGTCAAGCAATGTGCCTACGGCGCAGGGCGGAATCCCAGCGGCTCCGACAACGCCTGCG
CACCTGGATACCGTCAACCTGAAGCACCCCCACAAACTCTCCACAGTGATGAATGCCGTGACGGTGAAGA
GCAAAAAAGGCATCTATCTGCCAGCCGGCACCATTTTGACGGGCGTGTTGGTGAATGGGTTGCAGGCGGG
TACGGGGCCGCAAGCGAAAACCAATCCGCAGATCGTCGATATTCGTGTCAAGAAACGGGCCATTTTGCCC
AACGGATTACGCGCCAATCTCGAAAACTGCATGGCGATTGCCAGCGGATACGGCAGCATCGGCAACCAGA
GAGTCTACATGAGAACCAACATGCTTTCGTGCGTCGCACGAGGAGGCAAAGTCATCTCGGCACCCATCCA
TGCGTATATCGTGGGGTCCGACGGGCTGGTAGGCGTGTCTGGAAAAGTCGTATCGCATCAGGGACCGGCG
ATGATGAAGTCCTTTATCGCCGGCATCTTCTCGGGGCTCGGCAATGCGGTGCAGCCCATGGGTGTCCAGG
GCCTCAATCTCAACCCGGCATCGGGTAGTACCCAGGGATTCCAGATGCCTTCTCCAAGCTACATTGGAGC
CGAAGCCGCGGGCGGCGGGGTATCCACGGCGGCGGGCCAGATCTCCAAGTTCTACCTGAATGAAGCCGAG
TCCATGTTGCCGACGATCCAGGTCAACCCGGCCGTGGCAGTCAGCATGATTCTGGAGACGGGCGTGCGGG
TGCATACCGACGGTGAGAGCAAAGCGCAGATTCAGGAGGCCCAACTGCAGTCGGCACAATCATTGAACAA
CAGTCCGATGGCACTAGGCGGGATGCAAAGCCGCTACGGAGAAACATCGCCCTATGCGGGATCCGGCCAG
TCTCCCGCCGTAGCGTCCGCTTTCCCCGGTCAGGGTCAGTACAACAACTCACCGGAAGCCCAAACCCGTC
AGGAGTATGCCCGTCCATGA
 Primer design