SecReT4
Protein ID: 344201123
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3050
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2983729..2984895 [-]
ProductTraK lipoprotein
Component typeTraK_F
UniProt IDG0JUF4
KEGG IDafi:Acife_3050
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.3e-22, Aligned region: 168..372
Protein Sequence: 388 a.a.     [Download]
>gi|344201123|ref|YP_004785449.1| TraK lipoprotein [Acidithiobacillus ferrivorans SS3]
MMRRYWILCALALWPVTTLAGVMAPPPPTDTALTQGASLGQQGAAEYQQASAGSAAFAQGANNGSGRFVM
PSSPDRTSNLQQSPAFASLGHIPAAPSQPELTGGRMPAPMPPSAPGSAPYMPPATVTPPPAGASPYTIHS
AAMNTYGASNIPPHMSFKAARIGSIPVSTTDIRIVAGSTYAVPVSGVTPNLFATPFAHPRIIVGNKQYAQ
HFQHGSDAIISVTPSFPVGVYITGEHSSDPVASLTLIPKNSPAKNYRLVFPGFVPKRAPRMPDHSAYASV
MVNLIRDAVLDQVPDNYRQSRRIPDLVSPDPLSWSGLHHWIGAYYQIVSYKLTNHVHQAVDLAENDFYQK
GVLSVAFYPHHKLYPGESTQLYLVEALPASHRGLGAVW
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2984895-2983729 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGATGCGTCGTTACTGGATCCTCTGCGCCTTGGCCTTATGGCCGGTAACGACGCTCGCGGGCGTCATGG
CACCGCCGCCTCCTACAGATACCGCGCTGACGCAAGGAGCGAGCCTTGGCCAACAGGGGGCAGCAGAATA
TCAACAAGCCAGCGCAGGTAGTGCGGCATTCGCGCAAGGGGCAAATAACGGCTCGGGCCGGTTCGTCATG
CCGAGTTCGCCGGATCGCACTTCCAATCTGCAGCAGTCCCCCGCCTTTGCGAGCCTGGGGCACATACCCG
CAGCGCCAAGCCAGCCTGAATTGACCGGCGGCAGGATGCCTGCACCCATGCCGCCCAGCGCACCCGGTAG
CGCACCTTATATGCCACCAGCCACAGTGACCCCGCCGCCCGCCGGCGCCAGTCCGTACACGATCCATAGC
GCCGCAATGAATACCTATGGCGCGTCAAACATACCGCCACACATGAGTTTCAAGGCGGCACGCATCGGAA
GCATTCCAGTATCCACTACGGATATTCGGATTGTCGCGGGCTCGACGTATGCGGTCCCGGTATCCGGTGT
GACGCCCAATCTGTTTGCGACACCTTTCGCTCACCCCAGAATCATTGTGGGGAATAAACAGTACGCCCAG
CATTTCCAGCATGGATCAGATGCCATTATCAGCGTGACGCCATCGTTCCCGGTGGGGGTCTATATCACTG
GAGAACATTCCAGTGATCCAGTGGCGTCCCTGACCCTAATCCCGAAAAATAGTCCGGCCAAGAACTATCG
GCTGGTCTTCCCCGGATTTGTGCCGAAAAGAGCGCCAAGGATGCCAGACCATTCGGCCTATGCCAGCGTC
ATGGTGAATTTGATTCGGGACGCCGTGCTGGATCAGGTGCCGGACAATTATCGGCAAAGCCGACGGATCC
CCGACCTGGTATCTCCCGATCCATTGTCCTGGTCCGGGTTGCATCACTGGATCGGCGCCTATTACCAGAT
TGTGAGCTACAAGCTCACCAACCACGTCCATCAGGCCGTCGATCTGGCGGAAAACGACTTCTACCAGAAA
GGCGTGCTGTCCGTAGCTTTCTATCCGCACCACAAGCTCTATCCCGGAGAAAGCACGCAGCTCTACCTTG
TAGAAGCATTACCGGCCTCACACCGAGGGCTGGGGGCCGTATGGTAG
 Primer design