SecReT4
Protein ID: 344201124
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3051
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2984892..2985500 [-]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDG0JUF5
KEGG IDafi:Acife_3051
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.4e-08, Aligned region: 16..180
Protein Sequence: 202 a.a.     [Download]
>gi|344201124|ref|YP_004785450.1| type IV conjugative transfer system protein TraE [Acidithiobacillus ferrivorans SS3]
MNWGIFRKTYDKLAENSRLYLFVIVALVIVILSQQWMIFTIKTETRLVPPYLDRAVNIGYATASAGYYES
WGLYVAELVGNLTPGDATYVANSLGKLFDANDFAIVKGKVLATAAAERGDQANFFFQAKRTIWQAANKTV
FVYGLLSQINNLGQTVSKVHYTFSMAVHIEGGRPVLDNFNAYQGGPHTIKWAMVQEKDKRAK
 
Nucleotide Sequence: 609 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2985500-2984892 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
TTGAACTGGGGTATCTTTCGCAAAACCTACGACAAACTGGCGGAGAATAGTCGCCTGTACCTGTTCGTGA
TTGTGGCGCTCGTAATAGTGATTCTGTCCCAGCAGTGGATGATCTTCACGATAAAGACCGAGACCCGTCT
GGTGCCACCTTATCTCGATAGGGCCGTGAATATCGGGTACGCCACGGCCAGCGCCGGTTACTACGAGTCT
TGGGGCTTGTACGTCGCGGAGTTGGTCGGAAATCTTACGCCGGGCGACGCCACATACGTTGCCAACAGCC
TGGGTAAGCTGTTCGATGCCAACGATTTCGCCATCGTTAAAGGCAAGGTGCTCGCCACGGCAGCCGCTGA
GCGCGGGGACCAGGCGAACTTCTTTTTTCAGGCGAAGCGAACCATCTGGCAGGCGGCGAACAAAACGGTT
TTTGTCTACGGGCTTCTCAGCCAGATCAATAATCTCGGGCAGACCGTATCCAAGGTTCACTACACCTTTT
CCATGGCCGTACATATAGAAGGTGGCAGGCCAGTGCTGGATAACTTCAACGCCTATCAGGGCGGACCGCA
CACCATCAAATGGGCCATGGTTCAAGAAAAAGACAAGAGGGCGAAATGA
 Primer design