SecReT4
Protein ID: 344201125
T4SS name [ID]Tra_F [596]
Gene symbol-
Locus tagAcife_3052
StrainAcidithiobacillus ferrivorans SS3
Repliconchromosome [GenBank: NC_015942] [Browse all T4SS(s) in this replicon]
Location [Strand]2985497..2985775 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDG0JUF6
KEGG IDafi:Acife_3052
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-13, Aligned region: 4..79
Protein Sequence: 92 a.a.     [Download]
>gi|344201125|ref|YP_004785451.1| type IV conjugative transfer system protein TraL [Acidithiobacillus ferrivorans SS3]
MQAVRMPNHIDDTQQILFWDVEEVAVAAMFFIIGYVMRELTICIVLSIGVVYLFSGWKNNQLNGVLPHMS
YQFGWWRLNDVFRNGNIKEWIS
 
Nucleotide Sequence: 279 bp     [Download]
>gi|344198243|ref|NC_015942.1|:c2985775-2985497 Acidithiobacillus ferrivorans SS3 chromosome, complete genome
ATGCAAGCCGTGAGAATGCCGAACCACATTGACGACACTCAGCAGATCCTTTTCTGGGATGTGGAAGAAG
TCGCTGTGGCCGCGATGTTTTTCATCATCGGCTATGTGATGCGCGAACTGACCATCTGCATCGTGCTCAG
TATCGGTGTGGTGTACCTCTTTTCGGGCTGGAAGAACAACCAGCTCAATGGCGTACTCCCGCACATGAGC
TATCAGTTCGGATGGTGGCGGCTCAATGACGTCTTCCGGAATGGAAACATCAAGGAGTGGATCTCTTGA
 Primer design