SecReT4
Protein ID: 344207910
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2505
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2761353..2762504 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDG0K4Y9
KEGG IDbuj:BurJV3_2505
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-33, Aligned region: 68..303
Protein Sequence: 383 a.a.     [Download]
>gi|344207910|ref|YP_004793051.1| TrbL/VirB6 plasmid conjugal transfer protein [Stenotrophomonas maltophilia JV3]
MTIRWLANFDFSGGLQDLLGYAVRVQSIGDFVFFKLIMDYLRDRISDYGIDLMGRMMSWVGGIALVLMTL
WVLIQGFRIVTGRSRDSMMVLVTNMARAALIVSVATSMAMFGSNLQKFLNEDVKGLITHVVTGKDQQPED
QIDKSLAWMQVALSSIDGIKILNDPGLQADKTRALWFIGMGTGGPAVTAGAMLLLYEVALALFIGLGPLF
ILCLLFDQTKQLFQRWLFYGIGTMFSMAVLAAMVSIALDMVIRVSTAFWSTALVNKFLLEGASSDGMTSQ
AMQQGGMGLILTTLILTAPPMAAMFFQGTLGSFMAYSQIGGSPVAQAPGPSGQPPGSYYTPAQTKDHSSA
PSVSSGHGATSGYGIGRSGEVKQDTGKYGQAGT
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2762504-2761353 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGACGATCAGGTGGCTGGCCAACTTTGATTTCTCAGGCGGATTGCAGGATCTGCTGGGCTACGCTGTGC
GTGTCCAGTCGATCGGCGATTTCGTCTTCTTCAAGCTGATCATGGATTACCTGCGCGACAGGATCAGTGA
CTACGGCATCGACCTGATGGGGCGCATGATGTCCTGGGTCGGTGGCATTGCCCTGGTGCTGATGACGCTG
TGGGTACTGATCCAGGGCTTCCGGATCGTCACTGGCCGCAGCCGCGACTCCATGATGGTGCTGGTGACCA
ATATGGCGCGCGCGGCGTTGATTGTGAGCGTTGCCACCAGCATGGCGATGTTCGGCAGCAACCTGCAGAA
ATTCCTCAACGAGGACGTCAAAGGCCTGATCACCCACGTGGTGACCGGCAAGGACCAGCAGCCGGAAGAC
CAGATCGACAAGAGCTTGGCCTGGATGCAGGTGGCGCTGTCGAGCATTGATGGCATCAAGATCCTGAATG
ATCCAGGGTTGCAGGCGGACAAGACGCGGGCGCTGTGGTTCATCGGCATGGGCACGGGCGGTCCGGCCGT
CACTGCTGGTGCGATGTTGCTGCTCTACGAGGTCGCGCTGGCGCTGTTCATCGGCCTGGGTCCCTTGTTC
ATTCTGTGTCTGCTGTTCGACCAGACCAAGCAGCTGTTCCAGCGATGGCTGTTCTACGGCATCGGCACGA
TGTTCTCGATGGCGGTACTGGCAGCGATGGTATCGATCGCGCTGGACATGGTGATCCGTGTCTCGACCGC
GTTCTGGTCCACCGCCCTGGTCAACAAGTTCCTGCTCGAAGGCGCCTCCAGCGACGGCATGACCAGCCAG
GCGATGCAGCAGGGCGGCATGGGATTGATCCTGACGACCTTGATTCTGACTGCGCCCCCAATGGCGGCCA
TGTTCTTCCAGGGCACGCTGGGTAGCTTCATGGCATATTCGCAGATAGGTGGCAGCCCGGTTGCGCAGGC
ACCGGGCCCGAGTGGGCAGCCGCCGGGTAGCTACTACACGCCGGCCCAGACAAAGGATCATTCCAGTGCT
CCATCGGTCAGTTCCGGCCATGGCGCGACTTCTGGGTACGGTATTGGGCGATCAGGTGAGGTCAAGCAAG
ATACTGGAAAGTATGGGCAGGCTGGTACCTGA
 Primer design