SecReT4
Protein ID: 344207912
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2507
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2763456..2765903 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeVirB4
UniProt IDG0K4Z1
KEGG IDbuj:BurJV3_2507
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.6e-55, Aligned region: 171..376
AAA_10 [PF12846], Evalue: 2.6e-33, Aligned region: 439..718
Protein Sequence: 815 a.a.     [Download]
>gi|344207912|ref|YP_004793053.1| type IV secretion/conjugal transfer ATPase [Stenotrophomonas maltophilia JV3]
MFSPDTSISEFIPLSSHVAPNVVKTTGGDYLLTWHLEGLPFVGREEWELEHRHNTFNRLLQTLRAPDFVN
VAFWVHDIRRRRTLKGKSSYKQRFNQDVSDQYMGMLSSQRIMQNELYLTMIYRPVVAGKRFVEKSANVDK
LRAEQEQAVEKLMELAGNVEAVIRDYAPYRLGMYEAKNGVVFSETLELFGYLINRIDEPVPVLSAPIKDY
LPVSRHMFSAKTGDFAINTPNGANHFGAILNIKEYAEGTYPGILNGLKYLDYEYVITHSFSPMGRQDALK
VLDRTKGMMISSGDKAVSQIVELDQAMDQLSSGNFVLGEYHFIMAVYGDTQAKLSQNVASTRAELSNAGF
VSTKEDLAVTSSFYSQLPGNWRYRTRLANVSSLNFLGLSPLHNFATGKQHNNPWGDCVTTLQTTNGQPYY
FNFHATHPSENSLGEKAIANTMVIGKSGTGKTALINFLLSQVQKYEPSPTIFFFDKDRGAEIFVRACGGN
YLALENGAPTGFNPFQCENNEANVQFLADLIKVLAGKREYSAREEEDIYRAVESMLDTPMHLRSMTNFQK
SLPNMGDDGLYARMRRWTSGNSLGWVFDNPVDTVDLSKANIIGFDYTDIIDNPEVRVPVINYLLHRLESL
IDGRPLIYVMDEFWKILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALKSDISAALIEQTATLILL
PNPNASKSDYMDGLKLTEAEFRVVTALDERSRCFLVKQGHASSVCQLNLRGMDDILSVISASTDNIDIMH
RVLQTAAVRARVTVDELTPEQWLEDFYKNRKGSGKAAVEARDTVT
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2765903-2763456 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGTTCAGCCCTGACACCTCCATCAGTGAGTTCATCCCGTTGTCGTCGCATGTTGCCCCGAACGTGGTCA
AGACCACGGGCGGCGACTACCTGCTGACCTGGCATCTGGAAGGGCTGCCGTTCGTCGGCCGCGAGGAGTG
GGAGCTCGAGCATCGCCACAACACCTTCAACCGCCTGCTGCAGACGCTGCGCGCGCCGGATTTCGTCAAC
GTCGCCTTCTGGGTGCATGACATCCGTCGTCGCCGCACGCTGAAGGGCAAGAGCAGCTACAAGCAGCGCT
TCAACCAGGATGTGTCCGACCAGTACATGGGCATGCTGTCCTCGCAGCGCATCATGCAGAACGAGCTGTA
CCTGACCATGATCTACCGCCCGGTGGTGGCGGGTAAGCGCTTTGTCGAAAAGTCGGCGAACGTGGATAAG
CTGCGCGCCGAGCAGGAGCAGGCGGTCGAGAAGCTGATGGAGCTGGCCGGCAACGTCGAGGCCGTGATCC
GCGACTACGCGCCGTATCGCCTGGGCATGTACGAAGCCAAGAACGGCGTGGTGTTCTCTGAAACGCTGGA
GCTGTTCGGCTACCTGATCAATCGCATCGACGAGCCGGTACCGGTGCTGTCGGCACCGATCAAGGATTAC
CTGCCGGTCAGCCGCCACATGTTCTCGGCCAAGACCGGCGATTTCGCGATCAATACCCCCAATGGTGCCA
ACCATTTCGGCGCCATCCTGAACATCAAGGAGTATGCCGAGGGAACGTACCCGGGCATCCTCAATGGCCT
GAAGTACCTGGACTACGAATACGTCATCACCCATTCGTTCAGCCCGATGGGGCGCCAGGACGCGCTGAAG
GTGCTCGACCGCACCAAGGGCATGATGATCTCCTCCGGCGACAAGGCGGTCAGCCAGATCGTCGAGCTCG
ACCAGGCCATGGATCAGCTGTCGTCGGGCAACTTCGTGCTGGGTGAATACCACTTCATCATGGCGGTCTA
CGGCGACACCCAGGCCAAGCTCTCGCAGAACGTCGCCTCGACCCGCGCCGAGCTGTCCAACGCCGGTTTC
GTGTCGACCAAGGAAGACCTGGCGGTTACCTCGTCCTTCTATTCGCAGCTGCCGGGCAACTGGCGCTATC
GCACCCGCCTGGCCAATGTCAGCTCGCTGAATTTCCTGGGCCTGTCGCCGCTGCACAACTTCGCTACCGG
CAAGCAGCACAATAACCCGTGGGGCGACTGCGTGACCACGCTGCAGACCACCAACGGCCAGCCGTACTAC
TTCAATTTCCACGCGACCCACCCGTCGGAGAATTCGCTGGGCGAGAAGGCGATCGCCAACACCATGGTGA
TCGGCAAGTCCGGTACCGGTAAGACCGCGCTGATCAACTTCCTGCTCAGCCAGGTGCAGAAGTACGAGCC
GTCGCCGACCATCTTCTTCTTCGACAAGGACCGTGGTGCGGAGATTTTCGTGCGCGCCTGCGGTGGCAAT
TATCTTGCCCTGGAGAACGGCGCGCCGACCGGCTTCAACCCGTTCCAGTGCGAGAACAACGAAGCCAACG
TGCAGTTCCTGGCCGACCTGATCAAGGTGCTGGCCGGCAAGCGTGAGTACAGCGCCCGCGAGGAAGAGGA
TATCTATCGCGCGGTGGAGAGCATGCTCGACACGCCGATGCACCTGCGGAGCATGACCAACTTCCAGAAG
AGCCTGCCCAACATGGGCGACGATGGCCTCTACGCGCGTATGCGCCGCTGGACCTCGGGGAACTCGCTGG
GCTGGGTGTTCGACAATCCCGTGGATACCGTTGACCTGAGCAAGGCCAACATCATCGGCTTCGACTACAC
CGACATCATCGACAATCCTGAAGTGCGCGTGCCGGTCATCAACTACCTGCTGCACCGCCTGGAGTCGCTG
ATCGATGGTCGTCCGCTGATCTACGTGATGGACGAATTCTGGAAGATCCTGGACGGCGAGGGTGGCCTGA
AGGAATTCGCGAAGAACAAGCAGAAGACCATCCGTAAGCAGAACGGTCTGGGCATCTTCGCGACGCAGAG
CCCGGAGGACGCGCTGAAGAGCGATATCTCCGCCGCGCTGATCGAACAGACCGCCACGCTGATCCTGCTG
CCGAACCCGAATGCCAGCAAGAGCGATTACATGGACGGCCTGAAGCTGACCGAGGCCGAGTTCAGGGTGG
TTACCGCCCTGGACGAGCGCTCGCGCTGCTTCCTGGTCAAGCAGGGTCACGCGTCCAGCGTGTGCCAGCT
CAACCTGCGCGGCATGGATGACATTCTGTCGGTGATCTCGGCGTCCACTGACAACATCGACATCATGCAT
CGGGTATTGCAGACAGCCGCGGTACGCGCACGGGTGACGGTGGATGAGCTGACGCCGGAACAGTGGCTTG
AAGATTTCTACAAGAATCGAAAGGGCTCGGGCAAGGCGGCTGTCGAAGCGCGCGACACTGTTACCTGA
 Primer design