SecReT4
Protein ID: 344207913
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2508
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2765985..2766293 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDG0K4Z2
KEGG IDbuj:BurJV3_2508
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.1e-16, Aligned region: 4..79
Protein Sequence: 102 a.a.     [Download]
>gi|344207913|ref|YP_004793054.1| type IV secretory pathway VirB3 family protein [Stenotrophomonas maltophilia JV3]
MHKNVVFRGCTRPAMFLGVPYLPFFMVAGGLLLLSMYTNFWFLLTIPVAVFIMRQMAKRDEMIFRLLGLR
LMFKLKVRNVPEHDGMWVFNPNHYRDKPARMD
 
Nucleotide Sequence: 309 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2766293-2765985 Stenotrophomonas maltophilia JV3 chromosome, complete genome
GTGCATAAGAACGTCGTGTTCCGCGGCTGCACGCGCCCAGCGATGTTCCTGGGCGTCCCCTACCTGCCAT
TTTTCATGGTGGCAGGTGGGTTGTTGCTGCTCAGCATGTACACGAACTTCTGGTTCCTGCTCACCATTCC
GGTGGCGGTCTTCATCATGCGGCAGATGGCCAAGCGTGACGAAATGATCTTCCGGCTGCTGGGCCTGCGC
CTGATGTTCAAGCTGAAGGTGCGCAACGTGCCGGAACACGATGGCATGTGGGTGTTCAACCCCAACCATT
ACCGCGACAAGCCGGCCCGAATGGATTGA
 Primer design