SecReT4
Protein ID: 344207914
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2509
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2766286..2766696 [-]
Productconjugal transfer protein TrbC
Component typeVirB2
UniProt IDG0K4Z3
KEGG IDbuj:BurJV3_2509
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.3e-15, Aligned region: 9..107
Protein Sequence: 136 a.a.     [Download]
>gi|344207914|ref|YP_004793055.1| conjugal transfer protein TrbC [Stenotrophomonas maltophilia JV3]
MKRSNLDLVQAQRTLKTLLMATIFVGALFAPQVFATNTDFGGTDKKVCGFFSNINGLLNMASIAVVTIAV
IFAGYQIAFAHKRIGDVAPILIGGVLIGAAGQIARMLLGEGSDGKCGAGTSTTYYLINNAIQYYSA
 
Nucleotide Sequence: 411 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2766696-2766286 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGAAGCGATCCAATCTCGACCTCGTCCAGGCACAGCGCACGCTGAAGACCCTGCTGATGGCCACGATCT
TCGTTGGCGCACTGTTCGCCCCGCAGGTGTTCGCCACCAACACCGACTTCGGCGGCACCGACAAGAAGGT
CTGCGGTTTCTTCTCCAACATCAACGGCCTGCTGAACATGGCCTCGATCGCCGTGGTGACCATCGCGGTG
ATCTTCGCCGGCTACCAGATCGCCTTCGCTCACAAGCGTATCGGTGACGTCGCGCCGATCCTGATCGGTG
GCGTGCTGATCGGTGCCGCTGGCCAGATCGCGCGCATGCTGCTGGGCGAAGGCAGCGATGGCAAGTGCGG
TGCTGGCACCAGCACCACCTACTACCTGATCAACAACGCGATCCAGTACTACAGTGCATAA
 Primer design