SecReT4
Protein ID: 344207915
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2510
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2766770..2767753 [-]
Productlytic transglycosylase
Component typeVirB1
UniProt IDG0K4Z4
KEGG IDbuj:BurJV3_2510
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.7e-14, Aligned region: 15..138
Protein Sequence: 327 a.a.     [Download]
>gi|344207915|ref|YP_004793056.1| lytic transglycosylase [Stenotrophomonas maltophilia JV3]
MLPGLEMMACPEMAVSMDVMQHVINVESSRNPYAIGVVGGALVRQPKALDEALATVRMLEEKGYNFSIGL
AQVNRYNLGKYGLDSYEKAFQQCPNLQAGSRILAECYKRSGGDWGKSFSCYYSGNFETGFRHGYVQKVYD
SMRRGQMLASNGVAPINVVSRGERRSVKVEHHPQLASPAQARIVAQSNGPVYVPSEDPARAYVVYPSTGA
MARGSLLNIADQALSKVVLGSVDRMMQPQAQPAQGAAYPQQQAGGMPQQLPQRGAAQAMAMPQQLPGAAG
AGNEGPVMLRPWSERNQPVAGTDNSYNAPVQAAPVQQIPAGDAAFVF
 
Nucleotide Sequence: 984 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2767753-2766770 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGCTGCCAGGACTGGAAATGATGGCGTGCCCGGAGATGGCCGTATCGATGGACGTGATGCAGCACGTCA
TCAACGTTGAATCGTCGCGCAATCCCTACGCCATCGGCGTGGTCGGCGGTGCACTGGTGCGCCAGCCCAA
GGCCTTGGATGAAGCACTGGCGACGGTGCGCATGCTGGAAGAGAAGGGCTACAACTTCTCGATCGGGCTG
GCCCAGGTCAATCGCTACAACCTCGGCAAGTACGGCCTGGATTCCTACGAAAAGGCCTTCCAGCAGTGCC
CGAACCTGCAGGCGGGTTCGCGCATCCTCGCCGAGTGCTACAAGCGCTCCGGTGGTGACTGGGGCAAGTC
GTTCAGCTGCTACTACTCGGGCAATTTCGAGACCGGCTTCCGACACGGCTACGTGCAGAAGGTCTATGAC
TCCATGCGCCGCGGGCAGATGCTTGCGAGCAATGGTGTTGCACCGATCAACGTGGTCAGCCGTGGCGAGC
GCCGCAGCGTGAAGGTCGAGCATCATCCGCAGCTGGCATCTCCGGCGCAGGCGCGCATCGTTGCGCAGTC
CAATGGCCCGGTGTACGTGCCGTCGGAAGACCCGGCACGCGCGTATGTCGTGTACCCGTCCACCGGTGCG
ATGGCGCGGGGCAGCCTGCTGAACATCGCCGACCAGGCGCTGTCCAAGGTGGTGCTGGGCTCGGTGGATA
GGATGATGCAGCCGCAGGCGCAGCCGGCCCAAGGGGCCGCATATCCGCAGCAACAGGCCGGTGGCATGCC
GCAGCAGCTGCCTCAGCGGGGTGCTGCGCAGGCGATGGCCATGCCGCAACAGTTGCCGGGCGCTGCCGGC
GCGGGCAACGAAGGTCCGGTGATGTTGCGCCCCTGGAGCGAGCGTAACCAGCCTGTGGCCGGTACCGACA
ATTCGTACAACGCGCCGGTGCAGGCCGCACCGGTGCAGCAGATTCCCGCAGGGGATGCGGCCTTCGTGTT
CTAA
 Primer design