SecReT4
Protein ID: 344207916
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2511
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2767757..2768800 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDG0K4Z5
KEGG IDbuj:BurJV3_2511
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.7e-62, Aligned region: 27..325
Protein Sequence: 347 a.a.     [Download]
>gi|344207916|ref|YP_004793057.1| P-type DNA transfer ATPase VirB11 [Stenotrophomonas maltophilia JV3]
MDAEVSPLALVSSDFLRYQYEVLGIAEYMTSPEVTEICINRPGELYLETRAGWQRVDVPSLTFERARQFC
TAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPACDAGKVSITIRLPSKHTKSLSQYHEDGFFNQIL
ESDGSISEQDRELLELRHSREYAEFFRRAVMYRKNIVVSGATGSGKTTFMKALVNHIPDNERLVTIEDAR
ELFLTQPNVVHLLYSKGGQSTSNVSAKSCMEACLRMKPERIILAELRGDEAFYFIRNCASGHPGSITSCH
AGSPEQTWDQLALMVKASTEGSGLEFNVIKRLLMMTIDIVVHIKAHAGSRYITGIDFNPGRAQGQEG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2768800-2767757 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGGACGCCGAAGTGTCACCCCTCGCCCTCGTCTCCAGCGATTTCCTGCGCTATCAGTACGAAGTGCTGG
GCATCGCCGAGTACATGACTTCCCCGGAAGTGACGGAAATCTGCATCAACCGTCCCGGTGAGCTGTACCT
GGAAACCCGGGCGGGGTGGCAGCGGGTAGACGTGCCGAGCCTGACCTTCGAGCGGGCCCGGCAGTTCTGC
ACGGCGGTGGTGAACGAGAGCAACACCGGCCAGCGCATCACCGATGCCGATCCGGTCGTGTCGCTCACGT
TCCCCACCGGCCAGCGTGCGCAGTTCGTGATTCCGCCCGCATGTGACGCTGGCAAGGTGTCGATCACCAT
CCGTCTGCCGTCCAAGCACACCAAGTCGCTCAGCCAGTATCACGAAGATGGCTTCTTCAACCAGATCCTG
GAAAGCGATGGCAGCATCAGCGAGCAGGATCGCGAGCTGCTGGAGCTGCGCCATTCGCGCGAGTACGCCG
AGTTCTTCCGGCGTGCGGTGATGTACCGCAAGAACATCGTGGTATCCGGTGCGACCGGTAGTGGCAAGAC
CACCTTCATGAAGGCGCTGGTCAACCATATCCCGGACAATGAGCGCCTGGTCACGATCGAGGACGCGCGC
GAACTGTTCCTGACCCAGCCCAACGTCGTGCACCTGCTGTATTCCAAGGGTGGGCAAAGCACCAGCAATG
TCAGCGCCAAGAGCTGCATGGAAGCCTGCCTGCGCATGAAGCCCGAACGCATCATCCTGGCCGAGCTGCG
CGGTGACGAGGCGTTCTACTTCATCCGCAACTGCGCGTCCGGTCACCCAGGCTCGATCACCAGCTGCCAC
GCTGGCAGCCCGGAGCAGACCTGGGACCAGCTGGCCCTGATGGTGAAGGCCTCGACCGAAGGTTCGGGCC
TGGAATTCAATGTGATCAAGCGACTGTTGATGATGACCATCGACATCGTCGTGCATATCAAGGCGCATGC
CGGCTCGCGCTACATCACCGGCATCGACTTCAATCCTGGGCGTGCCCAGGGGCAGGAGGGCTGA
 Primer design