SecReT4
Protein ID: 344207917
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2512
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2768815..2770086 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDG0K4Z6
KEGG IDbuj:BurJV3_2512
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-49, Aligned region: 232..415
Protein Sequence: 423 a.a.     [Download]
>gi|344207917|ref|YP_004793058.1| conjugation TrbI family protein [Stenotrophomonas maltophilia JV3]
MSQQNTPGNDPNNGRDESQSPYGAQGAPDAQSNPYFGTTQAEPAPDLDAAAPQLRSAEEQRLNRKALLFL
GGIVLLLMAMGFLLFRKGQDDKDAVQKVPDVARATTPTLPDAVQTSPVPSQAMQPVDPIPMTPPLPPPPL
DSTPLFVPQSDSAREMDRGPTLLDRRIGSGSGVGGGDGQDGNGGNGGRGMDEYTRTMLAQLPNNQAAPAK
VRRGPDVEDVSSATYIQSPDALLVRGTYLRCVLETRIITDLAGYTSCLLTEPVYSINGRNLLLPKGSKIY
GAYGGGPMGKRVEVIWDRITTPNGIDVAMSSPGVDQLGGAGHPGQYSAHWGSRIASALMISLISDAFKYA
AAEHGPETTTIANNGMTVQSPYESATARTMERLANEALSSNRRPPTVTINQGTIVNVYVAKDVDFTNVLH
PRR
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2770086-2768815 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGAGCCAGCAGAACACTCCCGGAAACGACCCGAACAACGGACGCGACGAGAGCCAGAGCCCGTACGGCG
CACAAGGTGCCCCGGACGCGCAGTCGAACCCGTACTTCGGCACGACCCAGGCCGAGCCTGCGCCGGATCT
GGATGCGGCCGCACCGCAGCTGCGCTCGGCCGAAGAGCAGCGGCTGAACCGCAAGGCGCTGCTGTTCCTT
GGCGGCATCGTGCTGCTGCTGATGGCGATGGGCTTCCTGCTGTTCCGCAAGGGCCAGGATGACAAGGATG
CTGTGCAGAAGGTGCCGGATGTCGCGCGCGCCACCACGCCGACTCTGCCGGACGCCGTGCAGACGAGTCC
GGTGCCCTCCCAGGCCATGCAACCGGTTGATCCGATTCCGATGACGCCGCCGCTACCGCCGCCGCCGCTG
GATTCCACCCCGCTGTTCGTTCCCCAGTCCGATTCGGCACGCGAGATGGACCGTGGCCCGACTTTGCTGG
ACCGCCGCATCGGCTCCGGGAGCGGGGTGGGTGGTGGTGATGGACAGGATGGCAACGGGGGCAATGGCGG
CCGCGGCATGGATGAGTACACCCGTACCATGCTGGCCCAGCTGCCCAACAATCAGGCGGCGCCGGCAAAG
GTCCGTCGTGGGCCGGACGTGGAAGACGTCTCCAGTGCCACCTACATCCAGAGCCCCGATGCGCTGCTGG
TGCGTGGCACCTACCTGCGTTGCGTGCTGGAAACCCGCATCATCACCGATCTCGCCGGCTATACCTCGTG
CCTGCTGACCGAGCCGGTGTACTCGATCAATGGTCGCAACCTGCTGCTGCCGAAGGGCTCCAAGATCTAT
GGCGCTTACGGCGGCGGTCCGATGGGCAAGCGCGTGGAAGTGATCTGGGATCGCATCACCACCCCCAATG
GCATCGATGTTGCGATGTCCAGCCCGGGCGTGGATCAGCTGGGTGGCGCCGGTCATCCGGGCCAGTACAG
CGCGCACTGGGGCAGCCGTATCGCCTCGGCGCTGATGATCAGCCTGATTTCCGATGCCTTCAAGTACGCA
GCCGCCGAACACGGTCCGGAGACGACCACCATCGCCAACAATGGCATGACGGTGCAGTCGCCCTATGAGA
GTGCTACCGCACGCACGATGGAGCGCCTGGCCAACGAGGCCCTCAGCAGCAACCGTCGTCCGCCGACCGT
CACCATCAACCAGGGCACGATCGTGAACGTCTACGTTGCCAAGGACGTCGACTTCACCAACGTGCTCCAC
CCCCGCCGGTAA
 Primer design