SecReT4
Protein ID: 344207918
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2513
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2770083..2770862 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeVirB9
UniProt IDG0K4Z7
KEGG IDbuj:BurJV3_2513
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.8e-50, Aligned region: 28..255
Protein Sequence: 259 a.a.     [Download]
>gi|344207918|ref|YP_004793059.1| conjugal transfer protein TrbG/VirB9/CagX [Stenotrophomonas maltophilia JV3]
MSSRNIRGSALALLSMLSLLFSAAAMAQAVDHYEYEKDRIYPVRTGLGLTTQIELSPNEKILDYSTGFSS
GWELTRRENVFYLKPKNVDVDTNMMVRTETHSYIFELKVVATDWRQLEQARRAGVQYKIAFVYPNDTVFG
VAQEAVEEEAKPLLSSELAKDRQYNFNYSYSTSKAKKMGWLIPVNAYDDGRFTYLKLPNSPEYKTGIFPA
VFGRETEYGEDFVVNTTVEGNTLIVHGTHPYLVIRHGDFVVGLRRNVKK
 
Nucleotide Sequence: 780 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2770862-2770083 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGAGTAGTCGAAATATCAGGGGAAGCGCGCTGGCGCTGCTGTCGATGTTGTCGTTGCTGTTCTCAGCAG
CGGCGATGGCGCAGGCGGTTGACCACTACGAGTACGAGAAGGACCGCATCTATCCGGTTCGCACCGGCCT
GGGCCTGACCACCCAGATCGAGTTGAGCCCGAACGAGAAGATCCTCGACTACAGCACCGGCTTCAGCAGC
GGCTGGGAACTGACCCGTCGCGAGAACGTGTTCTATCTCAAGCCGAAGAACGTCGACGTCGACACCAACA
TGATGGTGCGCACCGAGACCCATTCCTACATCTTCGAGCTGAAGGTGGTGGCCACCGACTGGCGCCAGCT
GGAACAGGCCCGTCGCGCAGGCGTGCAGTACAAGATCGCCTTCGTCTATCCGAACGACACCGTGTTCGGC
GTCGCCCAGGAGGCGGTCGAGGAAGAGGCCAAGCCGTTGTTGAGCTCTGAACTGGCCAAGGACCGCCAGT
ACAACTTCAACTACTCCTATTCGACCAGCAAGGCGAAGAAGATGGGGTGGCTGATCCCGGTCAACGCCTA
TGACGATGGTCGTTTCACCTACCTGAAACTGCCGAATTCGCCGGAGTACAAGACCGGCATCTTCCCGGCG
GTGTTCGGTCGCGAAACGGAATACGGTGAAGACTTCGTGGTCAACACCACGGTTGAAGGCAATACGCTGA
TCGTGCACGGGACGCACCCGTACCTGGTCATCCGCCACGGCGACTTCGTCGTCGGCCTGCGAAGGAACGT
GAAGAAATGA
 Primer design