SecReT4
Protein ID: 344207919
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2514
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2770859..2771929 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDG0K4Z8
KEGG IDbuj:BurJV3_2514
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.6e-57, Aligned region: 20..240
Protein Sequence: 356 a.a.     [Download]
>gi|344207919|ref|YP_004793060.1| VirB8 family protein [Stenotrophomonas maltophilia JV3]
MFRKKDPGNSPKVEQSVAKAVSYEITVADMARRSERRAWWVATGSLLMSLALAGGYYYMLPLKEKVPFLV
MADAYTGTATVARLSGTFQGETITTNEAINRSNVAQYVLARESYDSAVMGLRDWELVFVMSTDPVAQSMR
VRYAGNNPQNPFVMYGRERAIRVKILSITPLGAEPNGSFRGASVRIQRSLLDKRTGVATYLDNQLVTMRF
GYNQNLALSEQDRILNPLAFQVTEYRVDNDYSRGVPVPDDGAMQAQAQQAAQAAQQAQGVYDPNNPAAAT
MIDPATGQPVAVPANGQVPGQSVQGQPMPGQPVQGQPMPGQPVQGQAMPGQAMPGQPAMRPAQNNSTGTA
DGASNR
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2771929-2770859 Stenotrophomonas maltophilia JV3 chromosome, complete genome
ATGTTCCGCAAGAAGGATCCCGGCAATAGTCCCAAGGTCGAGCAGTCGGTCGCCAAGGCGGTCAGCTACG
AGATCACCGTGGCCGACATGGCACGCCGCAGCGAGCGACGTGCGTGGTGGGTCGCCACAGGCTCATTGCT
GATGTCGCTCGCCCTCGCGGGCGGCTACTACTACATGCTGCCGCTGAAGGAGAAGGTGCCGTTCCTGGTG
ATGGCCGATGCCTACACCGGCACCGCGACCGTCGCGCGCCTGAGTGGCACCTTCCAGGGCGAGACGATCA
CCACCAACGAAGCGATCAATCGCAGCAACGTCGCCCAGTACGTGCTCGCGCGCGAATCGTACGACTCGGC
GGTGATGGGCCTGCGCGACTGGGAACTGGTGTTCGTGATGTCCACCGATCCGGTGGCGCAGTCCATGCGC
GTCCGCTATGCCGGCAACAACCCGCAGAACCCGTTCGTGATGTATGGCCGCGAGCGCGCCATCCGGGTCA
AGATCCTCAGCATCACGCCGCTGGGCGCCGAGCCGAACGGCAGCTTCCGCGGCGCTTCGGTGCGCATCCA
GCGCAGCCTGCTGGACAAGCGCACTGGCGTCGCCACCTACCTGGACAACCAGCTGGTGACGATGCGCTTC
GGCTACAACCAGAACCTGGCGCTGTCCGAACAGGATCGCATCCTCAATCCGCTGGCGTTCCAGGTCACCG
AGTACCGCGTCGACAACGACTACTCGCGTGGCGTGCCGGTACCGGATGACGGCGCCATGCAGGCGCAGGC
GCAGCAGGCCGCACAGGCCGCGCAGCAGGCGCAGGGTGTCTACGATCCCAACAATCCGGCCGCGGCCACG
ATGATCGATCCGGCTACCGGCCAGCCGGTCGCGGTTCCGGCCAACGGCCAGGTGCCGGGCCAGTCTGTAC
AGGGCCAACCCATGCCGGGCCAGCCTGTACAGGGTCAACCCATGCCGGGCCAGCCGGTGCAGGGGCAAGC
AATGCCGGGGCAGGCCATGCCCGGACAGCCGGCCATGAGGCCGGCGCAGAACAATTCCACCGGAACTGCT
GATGGAGCAAGCAACCGATGA
 Primer design