SecReT4
Protein ID: 344207921
T4SS name [ID]VirB [393]
Gene symbol-
Locus tagBurJV3_2516
StrainStenotrophomonas maltophilia JV3
Repliconchromosome [GenBank: NC_015947] [Browse all T4SS(s) in this replicon]
Location [Strand]2772897..2774576 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDG0K500
KEGG IDbuj:BurJV3_2516
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-107, Aligned region: 115..550
TraG-D_C [PF12696], Evalue: 3.3e-27, Aligned region: 402..515
TrwB_AAD_bind [PF10412], Evalue: 1.4e-23, Aligned region: 188..519
Protein Sequence: 559 a.a.     [Download]
>gi|344207921|ref|YP_004793062.1| TRAG family protein [Stenotrophomonas maltophilia JV3]
MLPSKKYLLIAIITLATLLLGFVFSGYLTLLFLGLDTQLFTWNTYYQYVHAIGQPQVAPFVGKIKWAGYV
GFGLPLLVLLVTGLVLLLKKDKRSLHGDARFATGADLAKHGMFKKTGQSIVVGSHGGKLVRLDGQQFVIL
AAPTRSGKGVGVVIPNLLEYGESLVVLDIKQENFDLTSGWRASQGQEIYLFNPFAEDRRTHRWNPLSYVS
DDPAFRVSDLMSIAAMLYPDGAEDQKFWVSQARNAFMAFTLYLFENWDDERSSGFPGGSGTPTLGAVYRL
SSGDGTDLKKYLKTLSERPFLSANARSAFANMLSQADETFASILGTFKEPLNPWINPVLDKATSCNDFLL
TDVRKKKMTIYIGIQPNKLAESRLIINLFFSQLINLNTKELPKSNPDLKYQCLLLMDEFTSIGKVEIIAS
AVSYMAGYNIRLLPIIQSMSQLDATYGREVSRTIITNHALQILYAPREQQDANDYSDMLGYTTVRKKNVT
HAREKTHNFTEERRALMLPQELKAMGPDMEVFLYEGIPHPVKCDKIRYYKDRYFTSRLLPKVDVPMLKV
 
Nucleotide Sequence: 1680 bp     [Download]
>gi|344205421|ref|NC_015947.1|:c2774576-2772897 Stenotrophomonas maltophilia JV3 chromosome, complete genome
GTGTTGCCCAGTAAGAAGTATCTGCTCATCGCCATCATCACGCTGGCGACCCTGCTGCTTGGTTTCGTGT
TTTCCGGTTACCTGACCCTGCTGTTCCTGGGGCTGGACACCCAGCTGTTCACCTGGAACACCTACTACCA
GTACGTCCACGCCATCGGCCAACCGCAGGTTGCGCCCTTCGTGGGCAAGATCAAATGGGCCGGCTACGTG
GGCTTCGGCCTGCCCCTGCTGGTGCTGCTGGTGACCGGCCTGGTGCTGCTGCTGAAGAAGGACAAGCGCT
CGCTGCACGGCGACGCGCGCTTCGCCACCGGTGCCGACCTGGCCAAGCACGGCATGTTCAAGAAGACCGG
CCAGAGCATCGTGGTCGGCAGCCATGGCGGCAAGCTGGTGCGCCTGGATGGCCAGCAGTTCGTGATCCTG
GCCGCGCCGACCCGCTCGGGCAAGGGCGTGGGCGTGGTCATCCCGAACCTGCTGGAGTACGGCGAATCAC
TGGTGGTGCTGGACATCAAGCAGGAGAACTTCGACCTGACCAGCGGCTGGCGCGCCAGCCAGGGCCAGGA
GATCTACCTGTTCAATCCCTTCGCCGAGGATCGGCGCACGCACCGCTGGAACCCGCTCAGCTACGTCTCC
GACGATCCGGCCTTCCGCGTCTCGGACCTGATGAGCATCGCTGCGATGCTGTATCCGGACGGGGCCGAGG
ACCAGAAATTCTGGGTCAGCCAGGCACGCAACGCGTTCATGGCCTTCACCCTGTACCTGTTCGAGAACTG
GGACGACGAGCGCAGCAGCGGTTTCCCGGGCGGCTCGGGCACGCCCACGCTGGGCGCGGTGTACCGGTTG
TCCTCCGGTGACGGCACCGACCTGAAGAAGTACCTCAAGACCCTGTCGGAGCGGCCATTCCTCAGTGCCA
ACGCCCGTTCGGCGTTCGCCAACATGCTGTCGCAGGCCGATGAGACCTTCGCTTCGATCCTGGGCACCTT
CAAGGAGCCGCTGAACCCCTGGATCAATCCGGTGCTGGACAAGGCCACCAGCTGCAACGACTTCCTGCTG
ACCGACGTCCGCAAGAAGAAGATGACCATCTATATCGGCATCCAGCCGAACAAGCTGGCCGAGAGCCGCC
TGATCATCAACCTGTTCTTCAGCCAGCTGATCAACCTCAACACCAAGGAACTGCCCAAGTCCAACCCGGA
CCTGAAGTACCAGTGCCTGCTGCTGATGGACGAATTCACCTCGATCGGCAAAGTGGAGATCATCGCCTCG
GCGGTGTCCTACATGGCAGGCTACAACATCCGCCTGCTGCCGATCATCCAGAGCATGTCGCAGCTCGATG
CCACCTATGGCCGTGAAGTCTCGCGCACGATCATCACCAACCACGCGCTGCAGATCCTGTACGCGCCGCG
CGAACAGCAGGATGCCAACGACTACTCGGACATGCTGGGCTACACCACGGTGCGCAAGAAGAACGTCACC
CATGCCCGCGAGAAGACCCACAACTTTACCGAGGAACGGCGCGCGCTGATGCTGCCGCAGGAGCTGAAGG
CGATGGGGCCGGACATGGAGGTGTTCCTGTACGAGGGCATACCGCATCCGGTGAAGTGCGACAAGATCCG
GTACTACAAGGACCGCTACTTCACGTCGAGGCTGCTGCCGAAGGTGGACGTTCCGATGCTCAAAGTCTGA
 Primer design