SecReT4
Protein ID: 34500496
T4SS name [ID]Trb [64]
Gene symboltrbG
Locus tagpUO1_18
StrainDelftia acidovorans plasmid pUO1 (NC_005088)
Repliconplasmid pUO1 [GenBank: NC_005088] [Browse all T4SS(s) in this replicon]
Location [Strand]24413..25333 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ76M35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.9e-66, Aligned region: 80..305
Protein Sequence: 306 a.a.     [Download]
>gi|34500496|ref|NP_904267.1| hypothetical protein pUO1_18 [Delftia acidovorans]
MNSRSSTMKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIK
PVAGSGGAIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKP
MDVGLETSLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGD
LSFDYELSGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIV
DTVFDHAILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|34500478|ref|NC_005088.1|:24413-25333 Delftia acidovorans B plasmid pUO1, complete sequence
ATGAATTCGAGGTCATCCACCATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGC
CCTCCCTGGCTCTGGCCGCCCCTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCT
GACCGCTCAAGAGCGCGCGGCGCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAG
CCGGTGGCCGGCTCGGGCGGTGCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATAGTTTGCGCGG
TGCTCCAGGTGTGCGACGTGGCCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGC
CAGGTGGACGGTGGAACCGGCCATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCG
ATGGACGTGGGCCTCGAAACCAGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCT
CGCATCGCACCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGC
GATCCAGCGCCGCGAGAAGCAGGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGAT
CTCTCGTTCGACTATGAGCTGTCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCA
AGACCATCATCGAAATGCCCGGCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGA
GGGCGGCTTGTTCACCGACGACGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTG
GACACGGTGTTTGACCACGCGATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCC
GGAGGAAGTGA
 Primer design