SecReT4
Protein ID: 345134063
T4SS name [ID]Tra_I [163]
Gene symboltraU
Locus tagR621a_p064
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R621a (NC_015965)
Repliconplasmid R621a [GenBank: NC_015965] [Browse all T4SS(s) in this replicon]
Location [Strand]54113..57157 [-]
ProductTraU nucleotide-binding protein
Component typeTraU_I
UniProt IDG2HK89
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-46, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|345134063|ref|YP_004823745.1| TraU nucleotide-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MNINRLIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFREMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISCVFERDPEMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALK
IRHEAFLDNVEQALRHSSDGLILRLLDIHEVGREIRRQTERHSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMASTWGKTREICTRNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEDLVDSALQDSGLYEKHDAAWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEELASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|345134005|ref|NC_015965.1|:c57157-54113 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R621a, complete sequence
ATGAACATAAACCGTCTCATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATTGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTTAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCTTTCAGGGAAATGGATGAAGCATCCGACCAGACTGGCCCTGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTGCGTTTTCGAGCGTGACCC
TGAAATGGGGAAAGAAGAAATCGAAGACATGGTCGCCCCACAAAAACGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGTTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACCGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGACCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTCTCC
GGCTACTGGATATACACGAGGTCGGACGTGAAATACGTCGTCAGACAGAACGGCACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCGGGATATCGCTGGACTGACGATGAATCCGTCCTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACGCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCCGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAGGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGCTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGACCCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCACACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGTGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCACTTAACAGGGCAGGCTCTGT
CTGGCGAGGCAAAGGGAATCTGATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CGTTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAAGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCGGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCCTCAACGGAAGACCTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAGCCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTATCCTCTATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAACTTCTGCTGG
ACTACATCCGCCGCGCTCTGGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTAAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACTCAGTATCTGA
GGGACTACCCGGAAAGTGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTGCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCGGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCG
TAAAACACTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGAACTGGCCT
CGGAGCTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design