SecReT4
Protein ID: 345134073
T4SS name [ID]Tra_I [163]
Gene symboltraM
Locus tagR621a_p074
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R621a (NC_015965)
Repliconplasmid R621a [GenBank: NC_015965] [Browse all T4SS(s) in this replicon]
Location [Strand]63591..64283 [-]
ProductTraM transfer protein
Component typeTraM_I
UniProt IDG2HK99
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2.7e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|345134073|ref|YP_004823755.1| TraM transfer protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFAGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|345134005|ref|NC_015965.1|:c64283-63591 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R621a, complete sequence
ATGACCGAAAACACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAGTCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGCCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design