SecReT4
Protein ID: 345134074
T4SS name [ID]Tra_I [163]
Gene symboltraL
Locus tagR621a_p075
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid R621a (NC_015965)
Repliconplasmid R621a [GenBank: NC_015965] [Browse all T4SS(s) in this replicon]
Location [Strand]64280..64627 [-]
ProductTraL transfer protein
Component typeTraL_I
UniProt IDG2HKA0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|345134074|ref|YP_004823756.1| TraL transfer protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYSL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|345134005|ref|NC_015965.1|:c64627-64280 Salmonella enterica subsp. enterica serovar Typhimurium plasmid R621a, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGTGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAGCCTATGA
 Primer design