SecReT4
Protein ID: 345301650
T4SS name [ID]Tra_F [119]
Gene symbol-
Locus tagEntas_4539
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T4SS(s) in this replicon]
Location [Strand]50147..50449 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDG2SD67
KEGG IDeas:Entas_4539
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.6e-32, Aligned region: 6..99
Protein Sequence: 100 a.a.     [Download]
>gi|345301650|ref|YP_004821598.1| type IV conjugative transfer system protein TraL [Enterobacter asburiae LF7a]
MNGEEDKYYFPETLNQQERYLGLPIDELIVTAPLVVLGVLNNMSVELSVIAGILWLLVRYLKKGQGSYWL
LNFCYWHLPSILFKVTFRQIPDSSFRHWRA
 
Nucleotide Sequence: 303 bp     [Download]
>gi|345301597|ref|NC_015963.1|:50147-50449 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAACGGGGAAGAGGATAAATACTACTTCCCGGAAACCCTGAATCAGCAGGAGCGTTATTTAGGTCTGC
CGATAGATGAATTAATTGTGACAGCACCCCTCGTTGTTCTGGGGGTGCTCAACAATATGTCTGTCGAACT
TTCCGTAATAGCGGGAATCCTCTGGCTTCTGGTCAGATATCTGAAGAAAGGGCAGGGGTCATACTGGTTG
CTTAATTTCTGTTACTGGCACCTGCCATCCATCCTTTTTAAAGTGACTTTTCGCCAGATACCTGATTCAA
GTTTCCGGCACTGGAGAGCGTAA
 Primer design