SecReT4
Protein ID: 345301671
T4SS name [ID]Tra_F [119]
Gene symbol-
Locus tagEntas_4560
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T4SS(s) in this replicon]
Location [Strand]65182..65970 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDG2SD88
KEGG IDeas:Entas_4560
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.5e-79, Aligned region: 33..252
Protein Sequence: 262 a.a.     [Download]
>gi|345301671|ref|YP_004821619.1| type-F conjugative transfer system pilin assembly protein TraF [Enterobacter asburiae LF7a]
MKRKCVLWGLLLAFAGQSALAEEIVTPADPFTGWAWYNEPKKPAESPKKPSQPAPQAVPDMSKLSAQEQA
KVLRGYTMEALNRAILYPTKENTATFLRWQKFWTDRGSMFSQSFAAAQLSHPDLDYNLEYPHYNSMAPFV
QTRDQQSRQNAVTQLAHQYGLFYFYRGSDPIDVQMAGVVADFAKTNGISLIPVSVDGQVAATLPQSRPDT
GQSRSMNITHFPALFLVDPASKNYRALSYGFMTQDDLSKRFLNVATGFKPNS
 
Nucleotide Sequence: 789 bp     [Download]
>gi|345301597|ref|NC_015963.1|:65182-65970 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAAACGAAAATGTGTCCTCTGGGGGCTGTTGCTGGCCTTTGCCGGTCAGTCAGCCCTGGCTGAAGAGA
TAGTGACACCGGCTGATCCGTTTACCGGCTGGGCCTGGTACAACGAACCGAAAAAACCTGCTGAGTCGCC
CAAAAAACCGTCACAGCCCGCGCCCCAGGCTGTGCCGGATATGAGTAAGCTGTCCGCGCAGGAGCAGGCA
AAAGTGTTGCGCGGGTACACGATGGAGGCGCTTAACCGCGCCATCCTGTACCCGACAAAAGAGAATACGG
CAACGTTCCTGCGCTGGCAGAAGTTCTGGACTGACCGGGGGTCGATGTTCAGCCAGTCCTTTGCAGCGGC
GCAGCTGAGCCACCCGGATCTCGATTACAACCTGGAATACCCGCACTACAACAGCATGGCCCCGTTTGTG
CAGACGCGTGACCAGCAGTCGCGGCAGAACGCGGTGACGCAGCTGGCGCACCAGTACGGTCTGTTTTACT
TCTACCGGGGCAGTGACCCGATTGATGTGCAGATGGCGGGGGTGGTGGCCGACTTTGCCAAAACGAACGG
AATATCACTTATTCCGGTGTCGGTGGATGGCCAGGTGGCGGCGACGCTGCCTCAGAGCCGCCCGGACACC
GGGCAGTCGCGGTCGATGAACATCACCCACTTCCCGGCCCTTTTCCTGGTCGACCCGGCCAGCAAAAACT
ACCGTGCCCTGTCCTACGGCTTCATGACCCAGGATGACCTGTCGAAGCGATTCCTGAACGTGGCCACCGG
CTTTAAACCGAATTCCTGA
 Primer design