SecReT4
Protein ID: 345301688
T4SS name [ID]Tra_F [119]
Gene symbol-
Locus tagEntas_4577
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T4SS(s) in this replicon]
Location [Strand]86406..87173 [-]
ProductTraX family protein
Component typeTraX_F
UniProt IDG2SDA5
KEGG IDeas:Entas_4577
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.2e-47, Aligned region: 23..252
Protein Sequence: 255 a.a.     [Download]
>gi|345301688|ref|YP_004821636.1| TraX family protein [Enterobacter asburiae LF7a]
MNQVVSDLLHPLQTPGKISPAALDMVKMLALGAMLIDHVNTLLLTTPEPLMYALGRMAFPLFTLIWAMNV
QCTPERLQKRANRLWIWAAFTQPVFSLAFAGHQPWWALNILFVFAGVTQLLALQYRYGKKGLMAGILLLG
ILVWPLSPASYGLSGLMLAGGLVMVTGGKTPGVQRTGVIVSGLSLCSLNGVSHLLGLPADTLLFAMLPTL
VLPLMAVSLSIQLCPDGCPRFMPRNFFYIAYAGHLLILLILMHVW
 
Nucleotide Sequence: 768 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c87173-86406 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGAATCAAGTGGTTTCCGACCTTCTTCACCCCCTTCAGACACCAGGGAAAATCAGTCCTGCCGCCCTGG
ATATGGTCAAAATGCTGGCGCTGGGTGCCATGCTCATCGACCACGTCAATACCCTGCTGCTGACGACACC
GGAACCCCTGATGTATGCGCTTGGCCGGATGGCCTTCCCCCTGTTCACGCTTATCTGGGCGATGAACGTG
CAGTGCACACCAGAACGGCTTCAGAAGAGGGCAAACCGGCTGTGGATATGGGCAGCGTTCACCCAGCCTG
TCTTCAGCCTGGCTTTTGCCGGACATCAGCCCTGGTGGGCACTGAACATCCTGTTCGTGTTCGCGGGCGT
CACGCAGCTGCTTGCCCTTCAGTACCGGTACGGGAAAAAAGGACTAATGGCAGGCATTCTGCTCCTGGGC
ATCCTGGTCTGGCCGCTGAGTCCGGCCAGCTACGGGCTGTCAGGCCTGATGCTGGCCGGCGGTCTGGTGA
TGGTGACGGGCGGGAAGACACCTGGCGTGCAGCGCACGGGAGTGATCGTGTCCGGGCTGTCGCTGTGCAG
TCTGAACGGGGTGTCGCATCTGCTGGGTCTGCCTGCCGACACGCTGCTGTTCGCCATGCTTCCCACGCTG
GTGCTCCCCCTGATGGCCGTTTCACTGAGCATTCAGCTGTGTCCGGATGGCTGTCCACGCTTTATGCCCC
GGAATTTTTTCTACATCGCTTATGCCGGGCACCTGCTGATACTGCTCATCCTGATGCATGTCTGGTGA
 Primer design